POU6F2 Polyclonal antibody

• 

  WB analysis using 33362-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 33362-1-AP (POU6F2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

POU6F2 Polyclonal Antibody for WB, ELISA

Cat No. 33362-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

POU domain, class 6, transcription factor 2, Retina-derived POU domain factor 1, RPF1, RPF-1

---

Tested Applications

• Positive WB detected in: mouse brain tissue, mouse cerebellum tissue, rat brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

33362-1-AP targets POU6F2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag38018

  Product name: Recombinant human POU6F2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-100 aa of NM_001166018

  Sequence: MSALLQDPMIAGQVSKPLLSVRSEMNAELRGEDKAATSDSELNEPLLAPVESNDSEDTPSKLFGARGNPALSDPGTPDQHQASQTHPPFPVGPQPLLTAQ

• Full Name: POU class 6 homeobox 2
• Calculated Molecular Weight: 691aa, 73 kDa
• Observed Molecular Weight: 73 kDa
• GenBank Accession Number: NM_001166018
• Gene Symbol: POU6F2
• Gene ID (NCBI): 11281
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: P78424
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.