PPARGC1B Polyclonal antibody

• Home
• Products
• Primary Antibodies
• PPARGC1B Polyclonal antibody (22378-1-AP)

• Featured Product
• KD/KO Validated

PPARGC1B Polyclonal Antibody for WB, ELISA

Cat No. 22378-1-AP

Publications(22)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (5)

Applications

WB, IP, CoIP, ELISA

Synonyms

ERRL1, PERC, Peroxisome proliferator activated receptor gamma coactivator 1 beta, Peroxisome proliferator-activated receptor gamma coactivator 1-beta, PGC1

• 

  WB analysis using 22378-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 22378-1-AP (PPARGC1B antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of mouse liver using 22378-1-AP

  IP result of anti-PPARGC1B (IP:22378-1-AP, 4ug; Detection:22378-1-AP 1:300) with mouse liver tissue lysate 4000ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: HEK-293 cells, SH-SY5Y cells, rat liver tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

22378-1-AP targets PPARGC1B in WB, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, pig, zebrafish, goat, fish, megalobrama amblycephala
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17566

  Product name: Recombinant human PPARGC1B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-350 aa of BC132971

  Sequence: MAGNDCGALLDEELSSFFLNYLADTQGGGSGEEQLYADFPELDLSQLDASDFDSATCFGELQWCPENSETEPNQYSPDDSELFQIDSENEALLAELTKTLDDIPEDDVGLAAFPALDGGDALSCTSASPAPSSAPPSPAPEKPSAPAPEVDELSLLQKLLLATSYPTSSSDTQKEGTAWRQAGLRSKSQRPCVKADSTQDKKAPMMQSQSRSCTELHKHLTSAQCCLQDRGLQPPCLQSPRLPAKEDKEPGEDCPSPQPAPASPRDSLALGRADPGAPVSQEDMQAMVQLIRYMHTYCLPQRKLPPQTPEPLPKACSNPSQQVRSRPWSRHHSKASWAEFSILRELLAQD

• Full Name: peroxisome proliferator-activated receptor gamma, coactivator 1 beta
• Calculated Molecular Weight: 1023 aa, 113 kDa
• Observed Molecular Weight: 100-110 kDa
• GenBank Accession Number: BC132971
• Gene Symbol: PPARGC1B
• Gene ID (NCBI): 133522
• RRID: AB_2879093
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q86YN6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PPARGC1B (Peroxisome Proliferator-Activated Receptor Gamma Coactivator 1-Beta) is a transcriptional coactivator that plays a key role in the regulation of cellular energy metabolism, particularly in tissues with high metabolic demands such as the heart, skeletal muscle, liver, and brain. Encoded by the PPARGC1B gene in humans, it interacts with a variety of nuclear receptors and transcription factors, including PPARs, ERRs, and NRF1, to promote the expression of genes involved in mitochondrial biogenesis, oxidative phosphorylation, fatty acid oxidation, and glucose homeostasis. Unlike its close paralog PGC-1α, PGC-1β is less responsive to physiological stimuli like cold exposure or exercise but is more constitutively expressed and tightly linked to lipid metabolism and reactive oxygen species (ROS) detoxification.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cancer Res; PGC-1α degradation suppresses mitochondrial biogenesis to confer radiation resistance in glioma; Authors - Mengjie Zhao
mouse	WB	Redox Biol; miR-484 mediates oxidative stress-induced ovarian dysfunction and promotes granulosa cell apoptosis via SESN2 downregulation; Authors - Xiaofei Wang
human	WB	Adv Sci (Weinh); Metabolism-Based Molecular Subtyping Endows Effective Ketogenic Therapy in p53-Mutant Colon Cancer; Authors - Meng Tang
mouse	WB	BMC Med; MTHFD2 promotes osteoclastogenesis and bone loss in rheumatoid arthritis by enhancing CKMT1-mediated oxidative phosphorylation; Authors - Yujing Li
Goat	WB	J Anim Sci Biotechnol; miR-25 modulates triacylglycerol and lipid accumulation in goat mammary epithelial cells by repressing PGC-1beta.; Authors - Liuan Ma
human	WB	Cell Rep; Muscle satellite cells are impaired in type 2 diabetic mice by elevated extracellular adenosine.; Authors - Lifang Han

Reviews

5.0 out of 5

1 verified customer reviews

What customers say

Automatically generated from the verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

Mounika (Verified Customer) (12-25-2025)

Antibodies are working good, visibility is good!

• Applications: Western Blot, Immunoprecipitation
• Primary Antibody Dilution: 1:400