PPARGC1B Polyclonal antibody

• 

  WB analysis using 22378-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 22378-1-AP (PPARGC1B antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse liver using 22378-1-AP

  IP result of anti-PPARGC1B (IP:22378-1-AP, 4ug; Detection:22378-1-AP 1:300) with mouse liver tissue lysate 4000ug.

• Featured Product
• KD/KO Validated

PPARGC1B Polyclonal Antibody for WB, ELISA

Cat No. 22378-1-AP

Publications(17)

Host / Isotype

Rabbit / IgG

Reactivity

human, rat, mouse and More (4)

Applications

WB, CoIP, ELISA

Synonyms

ERRL1, PERC, PGC 1 beta, PGC 1(beta), PGC1, PGC1B, PPAR gamma coactivator 1 beta, PPARGC 1 beta, PPARGC1, PPARGC1B

---

Tested Applications

• Positive WB detected in: HEK-293 cells, SH-SY5Y cells, rat liver tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 16 publications below
• CoIP: See 1 publications below

Product Information

22378-1-AP targets PPARGC1B in WB, CoIP, ELISA applications and shows reactivity with human, rat, mouse samples.

• Tested Reactivity: human, rat, mouse
• Cited Reactivity: human, mouse, pig, goat, fish, megalobrama amblycephala
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17566

  Product name: Recombinant human PPARGC1B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-350 aa of BC132971

  Sequence: MAGNDCGALLDEELSSFFLNYLADTQGGGSGEEQLYADFPELDLSQLDASDFDSATCFGELQWCPENSETEPNQYSPDDSELFQIDSENEALLAELTKTLDDIPEDDVGLAAFPALDGGDALSCTSASPAPSSAPPSPAPEKPSAPAPEVDELSLLQKLLLATSYPTSSSDTQKEGTAWRQAGLRSKSQRPCVKADSTQDKKAPMMQSQSRSCTELHKHLTSAQCCLQDRGLQPPCLQSPRLPAKEDKEPGEDCPSPQPAPASPRDSLALGRADPGAPVSQEDMQAMVQLIRYMHTYCLPQRKLPPQTPEPLPKACSNPSQQVRSRPWSRHHSKASWAEFSILRELLAQD

• Full Name: peroxisome proliferator-activated receptor gamma, coactivator 1 beta
• Calculated Molecular Weight: 1023 aa, 113 kDa
• Observed Molecular Weight: 100-110 kDa
• GenBank Accession Number: BC132971
• Gene Symbol: PPARGC1B
• Gene ID (NCBI): 133522
• RRID: AB_2879093
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q86YN6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Redox Biol; miR-484 mediates oxidative stress-induced ovarian dysfunction and promotes granulosa cell apoptosis via SESN2 downregulation; Authors - Xiaofei Wang
mouse	CoIP	Br J Pharmacol; Andrographolide prevents bone loss via targeting ERRalpha-regulated metabolic adaption of osteoclastogenesis.; Authors - Tongling Huang
mouse	WB	EMBO Rep; Mitophagy receptor FUNDC1 is regulated by PGC-1α/NRF1 to fine tune mitochondrial homeostasis.; Authors - Lei Liu ; KD Validated
Goat	WB	J Anim Sci Biotechnol; miR-25 modulates triacylglycerol and lipid accumulation in goat mammary epithelial cells by repressing PGC-1beta.; Authors - Liuan Ma
mouse	WB	Nutrients; Novel Choline-Deficient and 0.1%-Methionine-Added High-Fat Diet Induces Burned-Out Metabolic-Dysfunction-Associated Steatohepatitis with Inflammation by Rapid Immune Cell Infiltration on Male Mice; Authors - Takatoshi Sakaguchi
mouse	WB	FASEB J; Hypolipidemic effect of oleanolic acid is mediated by the miR-98-5p/PGC-1β axis in high-fat diet-induced hyperlipidemic mice.; Authors - Siyu Chen ; KD Validated