Product Information
60823-2-PBS targets CXCL7/PPBP as part of a matched antibody pair:
MP51217-1: 60823-1-PBS capture and 60823-2-PBS detection (validated in Cytometric bead array)
Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
| Tested Reactivity | human |
| Host / Isotype | Mouse / IgG2a |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag4147 Product name: Recombinant human PPBP protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 31-128 aa of BC028217 Sequence: TALASSTKGQTKRNLAKGKEESLDSDLYAELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDESAD Predict reactive species |
| Full Name | pro-platelet basic protein (chemokine (C-X-C motif) ligand 7) |
| Calculated Molecular Weight | 128 aa, 14 kDa |
| GenBank Accession Number | BC028217 |
| Gene Symbol | PPBP |
| Gene ID (NCBI) | 5473 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A Magarose purification |
| UNIPROT ID | P02775 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
