PPIL2 Recombinant monoclonal antibody

• 

  WB analysis using 87496-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87496-1-RR (PPIL2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 87496-1-RR

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 87496-1-RR (PPIL2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

PPIL2 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 87496-1-RR

Clone No.252848F8

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

Cyclophilin-60, Cyclophilin-like protein Cyp-60, Cyp-60, EC:2.3.2.27, hCyP-60

---

Tested Applications

• Positive WB detected in: mouse kidney tissue, HEK-293 cells, rat kidney tissue, mouse thymus tissue, mouse pancreas tissue, rat testis tissue, human kidney tissue

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87496-1-RR targets PPIL2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg6018

  Product name: Recombinant human PPIL2 protein

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 280-457 aa of NM_148176.2

  Sequence: GYVRLHTNKGDLNLELHCDLTPKTCENFIRLCKKHYYDGTIFHRSIRNFVIQGGDPTGTGTGGESYWGKPFKDEFRPNLSHTGRGILSMANSGPNSNRSQFFITFRSCAYLDKKHTIFGRVVGGFDVLTAMENVESDPKTDRPKEEIRIDATTVFVDPYEEADAQIAQERKTQLKVAP

• Full Name: peptidylprolyl isomerase (cyclophilin)-like 2
• Calculated Molecular Weight: 59 kDa
• GenBank Accession Number: NM_148176.2
• Gene Symbol: PPIL2
• Gene ID (NCBI): 23759
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q13356-2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Peptidylprolyl isomerase (cyclophilin)-like 2 (PPIL2), also known as Cyclophilin-like protein Cyp-60, is a U-box-type E3 ubiquitin ligase belonging to the cyclophilin family. PPIL2 is also a target of the JAK2/STAT5 pathway and upregulated in patients with MPNs (PMID: 36092721, 25992900). PPIL2 is a large ~60 kDa (520 amino acids) protein that has a central cyclophilin-like domain and also has an N-terminal U-box domain that exhibits E3 ligase activity. Western detected PPIL2 at an apparent molecular mass of 60~70 kDa (PMID: 40338661, 29352246).