PPM1E Polyclonal antibody, PBS Only

• 

  WB analysis using 25089-1-AP (same clone as 25089-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 25089-1-AP (PPM1E antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25089-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat brain using 25089-1-AP (same clone as 25089-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 25089-1-AP (PPM1E antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25089-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A431 using 25089-1-AP (same clone as 25089-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using PPM1E antibody (25089-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red). This data was developed using the same antibody clone with 25089-1-PBS in a different storage buffer formulation.

• 

  IF Staining of SH-SY5Y using 25089-1-AP (same clone as 25089-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed SH-SY5Y cells using PPM1E antibody (25089-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red). This data was developed using the same antibody clone with 25089-1-PBS in a different storage buffer formulation.

PPM1E Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 25089-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

25089-1-PBS targets PPM1E in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18751

  Product name: Recombinant human PPM1E protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 501-754 aa of BC136290

  Sequence: EESDWTENSFQGGQEDGGDDKENHGECKRPWPQHQCSAPADLGYDGRVDSFTDRTSLSPGSQINVLEDPGYLDLTQIEASKPHSAQFLLPVEMFGPGAPKKANLINELMMEKKSVQSSLPEWSGAGEFPTAFNLGSTGEQIYRMQSLSPVCSGLENEQFKSPGNRVSRLSHLRHHYSKKWHRFRFNPKFYSFLSAQEPSHKIGTSLSSLTGSGKRNRIRSSLPWRQNSWKGYSENMRKLRKTHDIPCPDLPWSY

• Full Name: protein phosphatase 1E (PP2C domain containing)
• Calculated Molecular Weight: 764 aa, 85 kDa
• Observed Molecular Weight: 85 kDa
• GenBank Accession Number: BC136290
• Gene Symbol: PPM1E
• Gene ID (NCBI): 22843
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8WY54
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Ca2+/calmodulin-dependent protein kinase phosphatase (CaMKP-N),also known as Ppm1E, is an AMPKα phosphatase,which is up-regulated in human gastric cancer tissues (PMID: 28423719).