PPM1E Recombinant monoclonal antibody, PBS Only (Capture)

• 

  Cytometric bead array sample test of MP03018-1

  The mean PPM1E concentration was determined to be 72.9 ng/mL in SH-SY5Y cell extract based on a 1.2 mg/mL extract load, 30.4 ng/mL in MKN45 cell extract based on a 1.2 mg/mL extract load, 18.8 ng/mL in A549 cell extract based on a 1.2 mg/mL extract load.

• 

  Cytometric bead array standard curve of MP03018-1

  Cytometric bead array standard curve of MP03018-1, PPM1E Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 87405-3-PBS. Detection antibody: 87405-2-PBS. Standard: Ag18903. Range: 0.625-80 ng/mL.

PPM1E Uni-rAb^® Recombinant Antibody for Cytometric bead array, Indirect ELISA

Cat No. 87405-3-PBS

Clone No.252801A6

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

Synonyms

---

Product Information

87405-3-PBS targets PPM1E as part of a matched antibody pair:

MP03018-1: 87405-3-PBS capture and 87405-2-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag18903

  Product name: Recombinant human PPM1E protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 501-754 aa of BC136290

  Sequence: EESDWTENSFQGGQEDGGDDKENHGECKRPWPQHQCSAPADLGYDGRVDSFTDRTSLSPGSQINVLEDPGYLDLTQIEASKPHSAQFLLPVEMFGPGAPKKANLINELMMEKKSVQSSLPEWSGAGEFPTAFNLGSTGEQIYRMQSLSPVCSGLENEQFKSPGNRVSRLSHLRHHYSKKWHRFRFNPKFYSFLSAQEPSHKIGTSLSSLTGSGKRNRIRSSLPWRQNSWKGYSENMRKLRKTHDIPCPDLPWSY

• Full Name: protein phosphatase 1E (PP2C domain containing)
• Calculated Molecular Weight: 764 aa, 85 kDa
• GenBank Accession Number: BC136290
• Gene Symbol: PPM1E
• Gene ID (NCBI): 22843
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8WY54
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.