PPP1R14D Polyclonal antibody, PBS Only

• 

  WB analysis using 22080-1-AP (same clone as 22080-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 22080-1-AP (PPP1R14D antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 22080-1-PBS in a different storage buffer formulation.

PPP1R14D Polyclonal Antibody for WB, Indirect ELISA

Cat No. 22080-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

22080-1-PBS targets PPP1R14D in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17246

  Product name: Recombinant human PPP1R14D protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-145 aa of BC096716

  Sequence: MLSSSPASCTSPSPDGENPCKKVHWASGRRRTSSTDSESKSHPDSSKIPRSRRPSRLTVKYDRGQLQRWLEMEQWVDAQVQELFQDQATPSEPEIDLEALMDLSTEEQKTQLEAILGNCPRPTEAFISELLSQLKKLRRLSRPQK

• Full Name: protein phosphatase 1, regulatory (inhibitor) subunit 14D
• Calculated Molecular Weight: 145 aa, 17 kDa
• Observed Molecular Weight: 21 kDa
• GenBank Accession Number: BC096716
• Gene Symbol: PPP1R14D
• Gene ID (NCBI): 54866
• RRID: AB_2878987
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NXH3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.