PPP1R3C Polyclonal antibody, PBS Only

• 

  WB analysis using 29424-1-AP (same clone as 29424-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 29424-1-AP (PPP1R3C antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 29424-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 29424-1-AP (same clone as 29424-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 29424-1-AP (PPP1R3C antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29424-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 29424-1-AP (same clone as 29424-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 29424-1-AP (PPP1R3C antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29424-1-PBS in a different storage buffer formulation.

PPP1R3C Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 29424-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

PP1 subunit R5, PPP1R5, Protein targeting to glycogen

---

Product Information

29424-1-PBS targets PPP1R3C in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30280

  Product name: Recombinant human PPP1R3C protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 42-185 aa of BC012625

  Sequence: PYDEFQRRHFVNKLKPLKSCLNIKHKAKSQNDWKCSHNQAKKRVVFADSKGLSLTAIHVFSDLPEEPAWDLQFDLLDLNDISSALKHHEEKNLILDFPQPSTDYLSFRSHFQKNFVCLENCSLQERTVTGTVKVKNVSFEKKVQ

• Full Name: protein phosphatase 1, regulatory (inhibitor) subunit 3C
• Calculated Molecular Weight: 317 aa, 36 kDa
• Observed Molecular Weight: 36 kDa
• GenBank Accession Number: BC012625
• Gene Symbol: PPP1R3C
• Gene ID (NCBI): 5507
• RRID: AB_2918304
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UQK1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

• Protein phosphatase 1 regulatory subunit 3C (PPP1R3C) is an enzyme that binds to protein phosphatase-1 (PP1) as a regulator. The central role of PPP1R3C is associated with glycogenesis and the overexpression of this gene increases glycogen storage. The cellular glycogen level is suppressed when PPP1R3C is knocked-down. PPP1R3C induces glycogen accumulation via HIF1 α during hypoxia and it is hypermethylated in melanoma (PMID: 25846879). Overexpression of PPP1R3C increased hepatic gluconeogenesis in vitro and in vivo while knockdown of PPP1R3C showed an opposite result (PMID: 31181215).