Product Information
29365-1-PBS targets PPP2R5A in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag31072 Product name: Recombinant human PPP2R5A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 48-129 aa of BC022474 Sequence: GSQAELHPLPQLKDATSNEQQELFCQKLQQCCILFDFMDSVSDLKSKEIKRATLNELVEYVSTNRGVIVESAYSDIVKMISA Predict reactive species |
| Full Name | protein phosphatase 2, regulatory subunit B', alpha isoform |
| Calculated Molecular Weight | 486 aa, 56 kDa |
| Observed Molecular Weight | 50-56 kDa |
| GenBank Accession Number | BC022474 |
| Gene Symbol | PPP2R5A |
| Gene ID (NCBI) | 5525 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q15172 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
Protein phosphatase 2, regulatory subunit B (B56), alpha isoform (PPP2R5A) is one of the regulatory subunits of the protein phosphatase 2A (PP2A), which is a major member of protein serine/threonine phosphatases in cells. PPP2R5A can regulate the cellular location, substrate specification and protein phosphatase function of PP2A, through which PPP2R5A plays an important role in many cellular activities. It has been reported that PPP2R5A relates with many diseases including cancers by regulating many crucial signaling pathways involved in P53, Bcl-2, CDK, MAPK, JAK/STAT, c-Myc and β-Catenin.
