PRDM13 Polyclonal antibody

• 

  WB analysis using 30453-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 30453-1-AP (PRDM13 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of rat eye using 30453-1-AP

  Immunohistochemical analysis of paraffin-embedded rat eye tissue slide using 30453-1-AP (PRDM13 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat eye using 30453-1-AP

  Immunohistochemical analysis of paraffin-embedded rat eye tissue slide using 30453-1-AP (PRDM13 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

PRDM13 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 30453-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

PR domain containing 13, PFM10, MU MB 20.220

---

Tested Applications

• Positive WB detected in: mouse kidney tissue, rat kidney
• Positive IHC detected in: rat eye tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

30453-1-AP targets PRDM13 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag31014

  Product name: Recombinant human PRDM13 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 518-707 aa of NM_021620

  Sequence: IDREIAMHNQQLSEMAAGKGRGRLDSGTLPPAVAAAGGTGGGGSGGSGAGKPKTGHLCLYCGKLYSRKYGLKIHMRTHTGYKPLKCKVCLRPFGDPSNLNKHIRLHAEGNTPYRCEFCGKVLVRRRDLERHVKSRHPGQSLLAKAGDGPGAEPGYPPEPGDPKSDDSDVDVCFTDDQSDPEVGGGGERDL

• Full Name: PR domain containing 13
• Calculated Molecular Weight: 74 kDa
• Observed Molecular Weight: 85 kDa
• GenBank Accession Number: NM_021620
• Gene Symbol: PRDM13
• Gene ID (NCBI): 59336
• RRID: AB_3086321
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H4Q3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.