Tested Applications
Positive WB detected in | HeLa cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:200-1:1000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 1 publications below |
Product Information
27718-1-AP targets PRDM2 in WB, ELISA applications and shows reactivity with Human samples.
Tested Reactivity | Human |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag26769 Product name: Recombinant human PRDM2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 142-264 aa of NM_001007257 Sequence: MGEDNPEIAAAIEEERASARSKRSSPKSRKGKKKSQENKNKGNKIQDIQLKTSEPDFTSANMRDSAEGPKEDEEKPSASALEQPATLQEVASQEVPPELATPAPAWEPQPEPDERLEAAACEVN Predict reactive species |
Full Name | PR domain containing 2, with ZNF domain |
Calculated Molecular Weight | 189 kDa |
Observed Molecular Weight | 250-280 kDa |
GenBank Accession Number | NM_001007257 |
Gene Symbol | PRDM2 |
Gene ID (NCBI) | 7799 |
RRID | AB_2880951 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q13029 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
PRDM2, also named as KMT8, RIZ, is a 1718 amino acid protein, which belongs to the class V-like SAM-binding methyltransferase superfamily. PRDM2 localizes in the nucleus and is highly expressed in retinoblastoma cell lines and in brain tumors and is also expressed in a number of other cell lines and in brain, heart, skeletal muscle, liver and spleen. Isoform 1 is expressed in testis at much higher level than isoform 3. PRDM2 as a S-adenosyl-L-methionine-dependent histone methyltransferase that specifically methylates 'Lys-9' of histone H3. May function as a DNA-binding transcription factor. The calculated molecular weight of PRDM2 is about 189 kDa. PRDM2 exists some isoforms with 250 kDa and 280 kDa. (PMID: 26040698)
Protocols
Product Specific Protocols | |
---|---|
WB protocol for PRDM2 antibody 27718-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |