PRDM2 Polyclonal antibody

• 

  WB analysis of HeLa using 27718-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 27718-1-AP (PRDM2 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

PRDM2 Polyclonal Antibody for WB, ELISA

Cat No. 27718-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

Human and More (1)

Applications

WB, ELISA

Synonyms

GATA 3 binding protein G3B, HUMHOXY1, KMT8, Lysine N methyltransferase 8, MTB ZF, MTE binding protein, PR domain containing protein 2, PRDM2, RIZ, RIZ1, RIZ2, Zinc finger protein RIZ

---

Tested Applications

• Positive WB detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

27718-1-AP targets PRDM2 in WB, ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26769

  Product name: Recombinant human PRDM2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 142-264 aa of NM_001007257

  Sequence: MGEDNPEIAAAIEEERASARSKRSSPKSRKGKKKSQENKNKGNKIQDIQLKTSEPDFTSANMRDSAEGPKEDEEKPSASALEQPATLQEVASQEVPPELATPAPAWEPQPEPDERLEAAACEVN

• Full Name: PR domain containing 2, with ZNF domain
• Calculated Molecular Weight: 189 kDa
• Observed Molecular Weight: 250-280 kDa
• GenBank Accession Number: NM_001007257
• Gene Symbol: PRDM2
• Gene ID (NCBI): 7799
• RRID: AB_2880951
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13029
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PRDM2, also named as KMT8, RIZ, is a 1718 amino acid protein, which belongs to the class V-like SAM-binding methyltransferase superfamily. PRDM2 localizes in the nucleus and is highly expressed in retinoblastoma cell lines and in brain tumors and is also expressed in a number of other cell lines and in brain, heart, skeletal muscle, liver and spleen. Isoform 1 is expressed in testis at much higher level than isoform 3. PRDM2 as a S-adenosyl-L-methionine-dependent histone methyltransferase that specifically methylates 'Lys-9' of histone H3. May function as a DNA-binding transcription factor. The calculated molecular weight of PRDM2 is about 189 kDa. PRDM2 exists some isoforms with 250 kDa and 280 kDa. (PMID: 26040698)

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nat Commun; Combinatorial ubiquitin code degrades deubiquitylation-protected substrates; Authors - Mai Morita