PRDM6 Polyclonal antibody

• 

  WB analysis using 33205-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 33205-1-AP (PRDM6 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

PRDM6 Polyclonal Antibody for WB, ELISA

Cat No. 33205-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

EC:2.1.1.361, PFM3, PR domain zinc finger protein 6, PR domain-containing protein 6, Putative histone-lysine N-methyltransferase PRDM6

---

Tested Applications

• Positive WB detected in: Jurkat cells, MCF-7 cells, MDA-MB-231 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

33205-1-AP targets PRDM6 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag38054

  Product name: Recombinant human PRDM6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 380-595 aa of NM_001136239

  Sequence: AQDENLNVPSTVMEAMCRQDALQPFNKSSKLAPTTQQRSVVFPQTPCSRNFSLLDKSGPIESGFNQINVKNQRVLASPTSTSQLHSEFSDWHLWKCGQCFKTFTQRILLQMHVCTQNPDRPYQCGHCSQSFSQPSELRNHVVTHSSDRPFKCGYCGRAFAGATTLNNHIRTHTGEKPFKCERCERSFTQATQLSRHQRMPNECKPITESPESIEVD

• Full Name: PR domain containing 6
• Calculated Molecular Weight: 595aa, 64 kDa
• Observed Molecular Weight: 75 kDa
• GenBank Accession Number: NM_001136239
• Gene Symbol: PRDM6
• Gene ID (NCBI): 93166
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9NQX0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PRDM6 is a poorly characterized member of the PRDF1 and RIZ1 homology domain-containing (PRDM) family of transcription factors that possess histone lysine methyltransferase activities through their catalytic SET domain. Based on findings in other species, PRDM6 is currently classified as a pseudo-methyltransferase that may interact with the methyltransferase G9a and corepressors to indirectly affect the methylation status of histone H3 lysine and histone H4 lysine. PRDM6 inhibition may have therapeutic value in PRDM6-expressing medulloblastomas (PMID: 38992221). PRDM6 has one glycosylation modification site.