Tested Applications
| Positive WB detected in | HEK-293 cells, HeLa cells, A431 cells, NIH/3T3 cells, mouse liver tissue, rat liver tissue |
| Positive IP detected in | mouse liver tissue |
| Positive IHC detected in | human lung cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:8000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
10308-1-AP targets AMPK Beta 1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0301 Product name: Recombinant human PRKAB1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 62-269 aa of BC001007 Sequence: AWQHDLEVNDKAPAQARPTVFRWTGGGKEVYLSGSFNNWSKLPLTRSHNNFVAILDLPEGEHQYKFFVDGQWTHDPSEPIVTSQLGTVNNIIQVKKTDFEVFDALMVDSQKCSDVSELSSSPPGPYHQEPYVCKPEERFRAPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLYALSIKDGVMVLSATHRYKKKYVTTLLYKP Predict reactive species |
| Full Name | protein kinase, AMP-activated, beta 1 non-catalytic subunit |
| Calculated Molecular Weight | 38 kDa |
| Observed Molecular Weight | 38 kDa |
| GenBank Accession Number | BC001007 |
| Gene Symbol | PRKAB1 |
| Gene ID (NCBI) | 5564 |
| RRID | AB_513239 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9Y478 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
AMPK Beta 1 (5'-AMP-activated protein kinase subunit beta-1) is also named as PRKAB1 and AMPK. AMPK, a serine/threonine kinase that exists as a heterotrimer comprised of a catalytic α-subunit and regulatory β- and γ-subunits, has been recognized as a sensor of cellular energy homeostasis (PMID: 21937710). AMPK regulates key metabolic enzymes, cell growth, apoptosis, gene transcription, and protein synthesis (PMID: 12829246). AMPK is an energy sensor and plays an essential role in the control of cellular bioenergetics by responding to various stresses including those that induce changes in the cellular AMP:ATP ratio or modulation in intracellular calcium (PMID: 27812976, PMID: 26616193). Recent studies have shown that AMPK mediates the inhibition of cell proliferation and growth of tumor cells (PMID: 16613876). AMPK also inhibits the expression of Glut1 and glycolysis in Tregs by inhibiting mTORC1 signaling (PMID: 25477880).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for AMPK Beta 1 antibody 10308-1-AP | Download protocol |
| IHC protocol for AMPK Beta 1 antibody 10308-1-AP | Download protocol |
| IP protocol for AMPK Beta 1 antibody 10308-1-AP | Download protocol |
| WB protocol for AMPK Beta 1 antibody 10308-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The AMPK Beta 1 Polyclonal antibody (Cat# 10308-1-AP) has 30 citations published in journals including Cell Metabolism, Autophagy, Theranostics, Acta Pharm Sin B, EMBO Journal, Cell Reports, Cell Death & Disease, J Exp Clin Cancer Res, and Food Chemistry. Research fields span AMPK signaling, metabolic regulation, liver disease (MASLD/steatosis), cancer (colorectal, breast, cervical, esophageal, hepatocellular), autophagy, obesity, lipid metabolism, neuroprotection, aging, and gut microbiota modulation.
| Species | Application | Title |
|---|---|---|
Cell Metab CircACC1 Regulates Assembly and Activation of AMPK Complex under Metabolic Stress.
| ||
Autophagy Buddleoside alleviates nonalcoholic steatohepatitis by targeting the AMPK-TFEB signaling pathway | ||
Theranostics Injectable SF-platform orchestrates GPX4-targeted ferroptosis-autophagy-immunogenic circuit for overcoming oxidative resistance in triple-negative breast cancer | ||
Theranostics Therapeutic inhibition of miR-802 protects against obesity through AMPK-mediated regulation of hepatic lipid metabolism. | ||
Acta Pharm Sin B Engineering cannabidiol synergistic carbon monoxide nanocomplexes to enhance cancer therapy via excessive autophagy | ||
Acta Pharm Sin B IMM-H007 promotes hepatic cholesterol and triglyceride metabolism by activating AMPKα to attenuate hypercholesterolemia. |













