Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

AMPK Beta 1 Polyclonal antibody

AMPK Beta 1 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF/ICC, IP, ELISA

PRKAB1, 5'-AMP-activated protein kinase subunit beta-1, AMPK, AMPK subunit beta 1, AMPK subunit beta-1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for AMPK Beta 1 in ?

Tested Applications

Positive WB detected inHEK-293 cells, HeLa cells, A431 cells, NIH/3T3 cells, mouse liver tissue, rat liver tissue
Positive IP detected inmouse liver tissue
Positive IHC detected inhuman lung cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:8000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10308-1-AP targets AMPK Beta 1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0301

Product name: Recombinant human PRKAB1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 62-269 aa of BC001007

Sequence: AWQHDLEVNDKAPAQARPTVFRWTGGGKEVYLSGSFNNWSKLPLTRSHNNFVAILDLPEGEHQYKFFVDGQWTHDPSEPIVTSQLGTVNNIIQVKKTDFEVFDALMVDSQKCSDVSELSSSPPGPYHQEPYVCKPEERFRAPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLYALSIKDGVMVLSATHRYKKKYVTTLLYKP

Predict reactive species
Full Name protein kinase, AMP-activated, beta 1 non-catalytic subunit
Calculated Molecular Weight 38 kDa
Observed Molecular Weight 38 kDa
GenBank Accession NumberBC001007
Gene Symbol PRKAB1
Gene ID (NCBI) 5564
RRIDAB_513239
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9Y478
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

AMPK Beta 1 (5'-AMP-activated protein kinase subunit beta-1) is also named as PRKAB1 and AMPK. AMPK, a serine/threonine kinase that exists as a heterotrimer comprised of a catalytic α-subunit and regulatory β- and γ-subunits, has been recognized as a sensor of cellular energy homeostasis (PMID: 21937710). AMPK regulates key metabolic enzymes, cell growth, apoptosis, gene transcription, and protein synthesis (PMID: 12829246). AMPK is an energy sensor and plays an essential role in the control of cellular bioenergetics by responding to various stresses including those that induce changes in the cellular AMP:ATP ratio or modulation in intracellular calcium (PMID: 27812976, PMID: 26616193). Recent studies have shown that AMPK mediates the inhibition of cell proliferation and growth of tumor cells (PMID: 16613876). AMPK also inhibits the expression of Glut1 and glycolysis in Tregs by inhibiting mTORC1 signaling (PMID: 25477880).

Protocols

Product Specific Protocols
IF protocol for AMPK Beta 1 antibody 10308-1-APDownload protocol
IHC protocol for AMPK Beta 1 antibody 10308-1-APDownload protocol
IP protocol for AMPK Beta 1 antibody 10308-1-APDownload protocol
WB protocol for AMPK Beta 1 antibody 10308-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The AMPK Beta 1 Polyclonal antibody (Cat# 10308-1-AP) has 30 citations published in journals including Cell Metabolism, Autophagy, Theranostics, Acta Pharm Sin B, EMBO Journal, Cell Reports, Cell Death & Disease, J Exp Clin Cancer Res, and Food Chemistry. Research fields span AMPK signaling, metabolic regulation, liver disease (MASLD/steatosis), cancer (colorectal, breast, cervical, esophageal, hepatocellular), autophagy, obesity, lipid metabolism, neuroprotection, aging, and gut microbiota modulation.

SpeciesApplicationTitle
humanWB,IP

Cell Metab

CircACC1 Regulates Assembly and Activation of AMPK Complex under Metabolic Stress.

Authors - Qidong Li
  • KD Validated
mouseWB

Autophagy

Buddleoside alleviates nonalcoholic steatohepatitis by targeting the AMPK-TFEB signaling pathway

Authors - Meng Chen

Theranostics

Injectable SF-platform orchestrates GPX4-targeted ferroptosis-autophagy-immunogenic circuit for overcoming oxidative resistance in triple-negative breast cancer

Authors - Hui Yuan
mouseWB,IF

Theranostics

Therapeutic inhibition of miR-802 protects against obesity through AMPK-mediated regulation of hepatic lipid metabolism.

Authors - Yangyue Ni
mouseWB

Acta Pharm Sin B

Engineering cannabidiol synergistic carbon monoxide nanocomplexes to enhance cancer therapy via excessive autophagy

Authors - Chang Xiao
mouseWB

Acta Pharm Sin B

IMM-H007 promotes hepatic cholesterol and triglyceride metabolism by activating AMPKα to attenuate hypercholesterolemia.

Authors - Jiaqi Li
Loading...
||
New chat

Able™

正在加载,请稍候...