AMPK Beta 1 Polyclonal antibody

• 

  WB analysis of mouse liver using 10308-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 10308-1-AP (AMPK beta 1 antibody at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 10308-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 10308-1-AP (AMPK beta 1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A431 using 10308-1-AP

  A431 cells were subjected to SDS PAGE followed by western blot with 10308-1-AP (AMPK beta 1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 10308-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 10308-1-AP (AMPK beta 1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse liver using 10308-1-AP

  IP result of anti-AMPK Beta 1 (IP:10308-1-AP, 4ug; Detection:10308-1-AP 1:5000) with mouse liver tissue lysate 1960 ug.

• 

  IHC staining of human lung cancer using 10308-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 10308-1-AP (AMPK beta 1 antibody at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung cancer using 10308-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 10308-1-AP (AMPK beta 1 antibody at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 10308-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using AMPK Beta 1 antibody (10308-1-AP) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002).

• Featured Product
• KD/KO Validated

AMPK Beta 1 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 10308-1-AP

Publications(21)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

PRKAB1, AMPKb, AMPK β, AMPK subunit beta-1, AMPK subunit beta 1

---

Tested Applications

• Positive WB detected in: mouse liver tissue, A431 cells, HEK-293 cells, HeLa cells
• Positive IP detected in: mouse liver tissue
• Positive IHC detected in: human lung cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 20 publications below
• IF: See 2 publications below
• IP: See 1 publications below

Product Information

10308-1-AP targets AMPK Beta 1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0301

  Product name: Recombinant human PRKAB1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 62-269 aa of BC001007

  Sequence: AWQHDLEVNDKAPAQARPTVFRWTGGGKEVYLSGSFNNWSKLPLTRSHNNFVAILDLPEGEHQYKFFVDGQWTHDPSEPIVTSQLGTVNNIIQVKKTDFEVFDALMVDSQKCSDVSELSSSPPGPYHQEPYVCKPEERFRAPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLYALSIKDGVMVLSATHRYKKKYVTTLLYKP

• Full Name: protein kinase, AMP-activated, beta 1 non-catalytic subunit
• Calculated Molecular Weight: 38 kDa
• Observed Molecular Weight: 38 kDa
• GenBank Accession Number: BC001007
• Gene Symbol: PRKAB1
• Gene ID (NCBI): 5564
• RRID: AB_513239
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y478
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

AMPK Beta 1 (5'-AMP-activated protein kinase subunit beta-1) is also named as PRKAB1 and AMPK. AMPK, a serine/threonine kinase that exists as a heterotrimer comprised of a catalytic α-subunit and regulatory β- and γ-subunits, has been recognized as a sensor of cellular energy homeostasis (PMID: 21937710). AMPK regulates key metabolic enzymes, cell growth, apoptosis, gene transcription, and protein synthesis (PMID: 12829246). AMPK is an energy sensor and plays an essential role in the control of cellular bioenergetics by responding to various stresses including those that induce changes in the cellular AMP:ATP ratio or modulation in intracellular calcium (PMID: 27812976, PMID: 26616193). Recent studies have shown that AMPK mediates the inhibition of cell proliferation and growth of tumor cells (PMID: 16613876). AMPK also inhibits the expression of Glut1 and glycolysis in Tregs by inhibiting mTORC1 signaling (PMID: 25477880).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IP	Cell Metab; CircACC1 Regulates Assembly and Activation of AMPK Complex under Metabolic Stress.; Authors - Qidong Li ; KD Validated
mouse	WB	Acta Pharm Sin B; Engineering cannabidiol synergistic carbon monoxide nanocomplexes to enhance cancer therapy via excessive autophagy; Authors - Chang Xiao
mouse	WB	Autophagy; Buddleoside alleviates nonalcoholic steatohepatitis by targeting the AMPK-TFEB signaling pathway; Authors - Meng Chen
mouse	WB,IF	Theranostics; Therapeutic inhibition of miR-802 protects against obesity through AMPK-mediated regulation of hepatic lipid metabolism.; Authors - Yangyue Ni
human,mouse	WB	J Ethnopharmacol; Mulberry leaves attenuate D-galactose-induced aging in vivo and in vitro; Authors - Yan Zhu
human	WB	Cell Signal; LAPTM5 confers cisplatin resistance in NSCLC by suppressing LAMP1 ubiquitination to stabilize lysosomal membranes and sustain autophagic flux; Authors - Fan Wu