Tested Applications
| Positive WB detected in | mouse brain tissue, human brain tissue, rat brain tissue |
| Positive IP detected in | mouse brain tissue |
| Positive IHC detected in | human gliomas tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 8 publications below |
| IHC | See 2 publications below |
| IP | See 1 publications below |
| CoIP | See 1 publications below |
Product Information
12555-1-AP targets Prion protein PrP/CD230 in WB, IHC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag3257 Product name: Recombinant human PrP protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 17-240 aa of BC022532 Sequence: SDLGLCKKRPKPGGWNTGGSRYPGQGSPGGNRYPPQGGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQGGGTHSQWNKPSKPKTNMKHMAGAAAAGAVVGGLGGYVLGSAMSRPIIHFGSDYEDRYYRENMHRYPNQVYYRPMDEYSNQNNFVHDCVNITIKQHTVTTTTKGENFTETDVKMMERVVEQMCITQYERESQAYYKRGSSMVLFSSPPV Predict reactive species |
| Full Name | prion protein |
| Calculated Molecular Weight | 34 kDa |
| Observed Molecular Weight | 30 kDa |
| GenBank Accession Number | BC022532 |
| Gene Symbol | PrP |
| Gene ID (NCBI) | 5621 |
| RRID | AB_2237745 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P04156 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Prion protein (PRNP) is a ubiquitous membrane glycoprotein whose abnormal self-replicating, misfolded form is widely believed to cause several central nervous system disorders, collectively known as Transmissible Spongiform Encephalopathies (TSE). Prion diseases are TSEs, attributed to conformational conversion of the cellular prion protein (PrPC) into an abnormal conformer that accumulates in the brain. The two isoforms, PrPC and PrPS, have the same primary amino acid sequence and only differ in conformation. While PrPC is composed of 42% α-helix and only 3% β-sheet, PrPSc is composed of 30% α-helix and 43% β-sheet. PrPC converts to its pathogenic isoform when the region corresponding to the residues 108-144 fold into β-sheets. PrPC is very soluble in detergents and easily digested by proteases while the PrPSc is insoluble in detergents and resistant to protease digestion. Prion diseases exist in infectious, sporadic, and genetic forms.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for Prion protein PrP/CD230 antibody 12555-1-AP | Download protocol |
| IP protocol for Prion protein PrP/CD230 antibody 12555-1-AP | Download protocol |
| WB protocol for Prion protein PrP/CD230 antibody 12555-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Neuron Muskelin Coordinates PrPC Lysosome versus Exosome Targeting and Impacts Prion Disease Progression. | ||
PLoS Biol TMED9 coordinates the clearance of misfolded GPI-anchored proteins out of the ER and into the Golgi | ||
Front Mol Biosci Single-cell transcriptomics uncover the key ferroptosis regulators contribute to cancer progression in head and neck squamous cell carcinoma | ||
Front Cell Dev Biol PRNP is a pan-cancer prognostic and immunity-related to EMT in colorectal cancer | ||
J Ethnopharmacol Huachansu Injection induces ferroptosis in multiple myeloma through NRF2/HO-1 signaling pathway | ||
Mol Carcinog Inhibition of the RBMS1/PRNP axis improves ferroptosis resistance-mediated oxaliplatin chemoresistance in colorectal cancer |















