PRODH2 Polyclonal antibody, PBS Only

• 

  WB analysis using 31047-1-AP (same clone as 31047-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 31047-1-AP (PRODH2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31047-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 31047-1-AP (same clone as 31047-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 31047-1-AP (PRODH2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31047-1-PBS in a different storage buffer formulation.

PRODH2 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 31047-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

31047-1-PBS targets PRODH2 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag33970

  Product name: Recombinant human PRODH2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 188-316 aa of BC166629

  Sequence: PTEEEPDSAAKSGEAWYEGNLGAMLRCVDLSRGLLEPPSLAEASLMQLKVTALTSTRLCKELASWVRRPGASLELSPERLAEAMDSGQNLQVSCLNAEQNQHLRASLSRLHRVAQYARAQHVRLLVDAE

• Full Name: proline dehydrogenase (oxidase) 2
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: BC166629
• Gene Symbol: PRODH2
• Gene ID (NCBI): 58510
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UF12
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PRODH2 is a dehydrogenase that converts trans-4-L-hydroxyproline to delta-1-pyrroline-3-hydroxy-5-carboxylate (Hyp) using ubiquinone-10 as the terminal electron acceptor. It can also use proline as a substrate but with a very much lower efficiency (PMID: 25697095).