PRPS2 Recombinant monoclonal antibody, PBS Only

PRPS2 Uni-rAb® Recombinant Antibody for WB, IF/ICC, Indirect ELISA
Cat No. 85090-5-PBS
Clone No.242657G2

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Indirect ELISA

242657G2, EC:2.7.6.1, PPRibP, PRS II, PRSII

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

85090-5-PBS targets PRPS2 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag25785

Product name: Recombinant human PRPS2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 143-273 aa of BC119662

Sequence: IPVDNLYAEPAVLQWIRENIAEWKNCIIVSPDAGGAKRVTSIADRLNVEFALIHKERKKANEVDRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATKVYAILTHGIFSGPAISRINNAAFEAVV

Predict reactive species
Full Name phosphoribosyl pyrophosphate synthetase 2
Observed Molecular Weight 30-34 kDa
GenBank Accession NumberBC119662
Gene Symbol PRPS2
Gene ID (NCBI) 5634
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP11908
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

PRPS (phosphoribosyl pyrophosphate synthetase) proteins catalyze the synthesis of phosphoribosyl pyrophosphate (PRPP). Three human PRPS isoforms exist and are encoded by three different genes. PRPS1 and PRPS2 (also known as PRS1 and PRS2, respectively) are ubiquitously expressed, while PRPS3 (also known as PRPS1L1) is specific to the testis. PRPP is an important substrate synthesized from MgATP and ribose-5-phosphate in a reaction that requires inorganic phosphate and magnesium as a cofactor. PRPP is essential in the synthesis of nearly all nucleotides, implying that PRPS proteins play an important role in nucleotide biosynthesis and purine metabolism. PRPS2 is a 318 amino acid protein that exists as a homodimer and a hexamer composed of three homodimers.

Loading...
||
New chat Able
正在加载,请稍候...