PRPS2 Recombinant monoclonal antibody

PRPS2 Uni-rAb® Recombinant Antibody for WB, IF/ICC, ELISA
Cat No. 85090-5-RR
Clone No.242657G2

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, ELISA

242657G2, EC:2.7.6.1, PPRibP, PRS II, PRSII

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inJurkat cells, rat spleen tissue, HeLa cells, HepG2 cells, NIH/3T3 cells, mouse spleen tissue
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

85090-5-RR targets PRPS2 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag25785

Product name: Recombinant human PRPS2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 143-273 aa of BC119662

Sequence: IPVDNLYAEPAVLQWIRENIAEWKNCIIVSPDAGGAKRVTSIADRLNVEFALIHKERKKANEVDRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATKVYAILTHGIFSGPAISRINNAAFEAVV

Predict reactive species
Full Name phosphoribosyl pyrophosphate synthetase 2
Observed Molecular Weight 30-34 kDa
GenBank Accession NumberBC119662
Gene Symbol PRPS2
Gene ID (NCBI) 5634
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP11908
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PRPS (phosphoribosyl pyrophosphate synthetase) proteins catalyze the synthesis of phosphoribosyl pyrophosphate (PRPP). Three human PRPS isoforms exist and are encoded by three different genes. PRPS1 and PRPS2 (also known as PRS1 and PRS2, respectively) are ubiquitously expressed, while PRPS3 (also known as PRPS1L1) is specific to the testis. PRPP is an important substrate synthesized from MgATP and ribose-5-phosphate in a reaction that requires inorganic phosphate and magnesium as a cofactor. PRPP is essential in the synthesis of nearly all nucleotides, implying that PRPS proteins play an important role in nucleotide biosynthesis and purine metabolism. PRPS2 is a 318 amino acid protein that exists as a homodimer and a hexamer composed of three homodimers.

Protocols

Product Specific Protocols
IF protocol for PRPS2 antibody 85090-5-RRDownload protocol
WB protocol for PRPS2 antibody 85090-5-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...