PRRG1 Polyclonal antibody

• 

  WB analysis of HepG2 using 14103-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 14103-1-AP (PRRG1 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HepG2 using 14103-1-AP

  IP result of anti-PRRG1 (IP:14103-1-AP, 4ug; Detection:14103-1-AP 1:300) with HepG2 cells lysate 3200ug.

PRRG1 Polyclonal Antibody for WB, IP, ELISA

Cat No. 14103-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, ELISA

Synonyms

PRGP1, Proline rich Gla protein 1, PRRG1, TMG1

---

Tested Applications

• Positive WB detected in: HepG2 cells
• Positive IP detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 1 publications below

Product Information

14103-1-AP targets PRRG1 in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5236

  Product name: Recombinant human PRRG1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 102-218 aa of BC060833

  Sequence: WRCFLRNKTRRQTVTEGHIPFPQHLNIITPPPPPDEVFDSSGLSPGFLGYVVGRSDSVSTRLSNCDPPPTYEEATGQVNLQRSETEPHLDPPPEYEDIVNSNSASAIPMVPVVTTIK

• Full Name: proline rich Gla (G-carboxyglutamic acid) 1
• Calculated Molecular Weight: 218 aa, 23 kDa
• Observed Molecular Weight: 24 kDa
• GenBank Accession Number: BC060833
• Gene Symbol: PRRG1
• Gene ID (NCBI): 5638
• RRID: AB_2878013
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O14668
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Clin Transl Med; Vitamin K-dependent gamma-carboxyglutamic acid protein 1 promotes pancreatic ductal adenocarcinoma progression through stabilizing oncoprotein KRAS and tyrosine kinase receptor EGFR; Authors - Zheng Wu ; KD Validated