Tested Applications
Positive WB detected in | HepG2 cells |
Positive IP detected in | HepG2 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 1 publications below |
WB | See 1 publications below |
Product Information
14103-1-AP targets PRRG1 in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag5236 Product name: Recombinant human PRRG1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 102-218 aa of BC060833 Sequence: WRCFLRNKTRRQTVTEGHIPFPQHLNIITPPPPPDEVFDSSGLSPGFLGYVVGRSDSVSTRLSNCDPPPTYEEATGQVNLQRSETEPHLDPPPEYEDIVNSNSASAIPMVPVVTTIK Predict reactive species |
Full Name | proline rich Gla (G-carboxyglutamic acid) 1 |
Calculated Molecular Weight | 218 aa, 23 kDa |
Observed Molecular Weight | 24 kDa |
GenBank Accession Number | BC060833 |
Gene Symbol | PRRG1 |
Gene ID (NCBI) | 5638 |
RRID | AB_2878013 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | O14668 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for PRRG1 antibody 14103-1-AP | Download protocol |
IP protocol for PRRG1 antibody 14103-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |