Trypsin 1/PRSS1 Polyclonal antibody

• 

  IHC staining of mouse brain using 29790-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 29790-1-AP (PRSS1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 29790-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using PRSS1 antibody (29790-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2).

Trypsin 1/PRSS1 Polyclonal Antibody for IHC, IF/ICC, ELISA

Cat No. 29790-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, IF/ICC, ELISA

Synonyms

PRSS1, TRYP1, TRY1, TRP1, Beta trypsin

---

Tested Applications

• Positive IHC detected in: mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

29790-1-AP targets Trypsin 1/PRSS1 in IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag31383

  Product name: Recombinant human PRSS1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 24-140 aa of BC128226

  Sequence: IVGGYNCEENSVPYQVSLNSGYHFCGGSLINEQWVVSAGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPQYDRKTLNNDIMLIKLSSRAVINARVSTISLPTAPPATGTKCL

• Full Name: protease, serine, 1 (trypsin 1)
• Calculated Molecular Weight: 27 kDa
• GenBank Accession Number: BC128226
• Gene Symbol: PRSS1
• Gene ID (NCBI): 5644
• RRID: AB_3669696
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P07477
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PRSS1 encodes a trypsinogen, which is a member of the trypsin family of serine proteases. This enzyme is secreted by the pancreas and cleaved to its active form in the small intestine. It is active on peptide linkages involving the carboxyl group of lysine or arginine. Mutations in this gene are associated with hereditary pancreatitis. This gene and several other trypsinogen genes are localized to the T cell receptor beta locus on chromosome 7.