PSAT1 Polyclonal antibody

• 

  WB analysis of HEK-293 using 20180-1-AP

  WB result of PSAT1 antibody (20180-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-PSAT1 transfected HEK-293 cells.

• 

  WB analysis using 20180-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 20180-1-AP (PSAT1 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HeLa using 20180-1-AP

  IP result of anti-PSAT1 (IP:20180-1-AP, 4ug; Detection:20180-1-AP 1:2000) with HeLa cells lysate 2520 ug.

• 

  IHC staining of human lung cancer using 20180-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 20180-1-AP (PSAT1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 20180-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 20180-1-AP (PSAT1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HepG2 using 20180-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using PSAT1 antibody (20180-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

PSAT1 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 20180-1-AP

Publications(10)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

EC:2.6.1.52, EPIP, Phosphoserine aminotransferase, PSA, PSAT

---

Tested Applications

• Positive WB detected in: HeLa cells, HEK-293 cells, A549 cells, K-562 cells, mouse brain tissue, rat brain tissue
• Positive IP detected in: HeLa cells
• Positive IHC detected in: human lung cancer tissue, human breast cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 7 publications below
• IHC: See 1 publications below

Product Information

20180-1-AP targets PSAT1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14044

  Product name: Recombinant human PSAT1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-370 aa of BC001618

  Sequence: MDAPRQVVNFGPGPAKLPHSVLLEIQKELLDYKGVGISVLEMSHRSSDFAKIINNTENLVRELLAVPDNYKVIFLQGGGCGQFSAVPLNLIGLKAGRCADYVVTGAWSAKAAEEAKKFGTINIVHPKLGSYTKIPDPSTWNLNPDASYVYYCANETVHGVEFDFIPDVKGAVLVCDMSSNFLSKPVDVSKFGVIFAGAQKNVGSAGVTVVIVRDDLLGFALRECPSVLEYKVQAGNSSLYNTPPCFSIYVMGLVLEWIKNNGGAAAMEKLSSIKSQTIYEIIDNSQGFYVCPVEPQNRSKMNIPFRIGNAKGDDALEKRFLDKALELNMLSLKGHRSVGGIRASLYNAVTIEDVQKLAAFMKKFLEMHQL

• Full Name: phosphoserine aminotransferase 1
• Calculated Molecular Weight: 370 aa, 40 kDa
• Observed Molecular Weight: 37-40 kDa
• GenBank Accession Number: BC001618
• Gene Symbol: PSAT1
• Gene ID (NCBI): 29968
• RRID: AB_10665948
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y617
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PSAT1, also named as PSA and PSAT, belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family and SerC subfamily. It catalyzes the reversible conversion of 3-phosphohydroxypyruvate to phosphoserine and of 3-hydroxy-2-oxo-4-phosphonooxybutanoate to phosphohydroxythreonine. PSAT1 represents a new interesting target for CRC therapy. (PMID:18221502) It may be implicated in altered serine metabolism and schizophrenia spectrum conditions. (PMID:20955740 )

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Science; mTORC1 induces purine synthesis through control of the mitochondrial tetrahydrofolate cycle.; Authors - Issam Ben-Sahra
human	IHC	EMBO Mol Med; Macrophages induce malignant traits in mammary epithelium via IKKε/TBK1 kinases and the serine biosynthesis pathway.; Authors - Ewa Wilcz-Villega
mouse	WB	Proc Natl Acad Sci U S A; Interleukin-6 mediates PSAT1 expression and serine metabolism in TSC2-deficient cells.; Authors - Ji Wang
human	WB	EMBO Rep; The breast cancer oncogene IKKε coordinates mitochondrial function and serine metabolism.; Authors - Ruoyan Xu
mouse	WB	Elife; The mTORC1-mediated activation of ATF4 promotes protein and glutathione synthesis downstream of growth signals.; Authors - Margaret E Torrence
mouse	WB	Mol Metab; Hepatic mTORC1 signaling activates ATF4 as part of its metabolic response to feeding and insulin.; Authors - Vanessa Byles