PSAT1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• PSAT1 Polyclonal antibody (20180-1-AP)

• Featured Product
• KD/KO Validated

PSAT1 Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Cat No. 20180-1-AP Copied!

Publications (14)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Synonyms

EC:2.6.1.52, EPIP, Phosphoserine aminotransferase, PSA, PSAT

• 

  WB analysis of HEK-293 using 20180-1-AP

  WB result of PSAT1 antibody (20180-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-PSAT1 transfected HEK-293 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 20180-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 20180-1-AP (PSAT1 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HeLa using 20180-1-AP

  IP result of anti-PSAT1 (IP:20180-1-AP, 4ug; Detection:20180-1-AP 1:2000) with HeLa cells lysate 2520 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 20180-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 20180-1-AP (PSAT1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 20180-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 20180-1-AP (PSAT1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 20180-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using PSAT1 antibody (20180-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of HeLa using 20180-1-AP

  1x10^6 HeLa cells were intracellularly stained with 0.25 ug PSAT1 Polyclonal antibody (20180-1-AP) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug Isotype Control (blue). Cells were fixed and permeabilized with Intracellular Flow Cytometry Fixation & Permeabilization Buffer Kit (PF00019).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for PSAT1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HeLa cells, HEK-293 cells, A549 cells, K-562 cells, mouse brain tissue, rat brain tissue
• Positive IP detected in: HeLa cells
• Positive IHC detected in: human lung cancer tissue, human breast cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells
• Positive FC (Intra) detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

20180-1-AP targets PSAT1 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14044

  Product name: Recombinant human PSAT1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-370 aa of BC001618

  Sequence: MDAPRQVVNFGPGPAKLPHSVLLEIQKELLDYKGVGISVLEMSHRSSDFAKIINNTENLVRELLAVPDNYKVIFLQGGGCGQFSAVPLNLIGLKAGRCADYVVTGAWSAKAAEEAKKFGTINIVHPKLGSYTKIPDPSTWNLNPDASYVYYCANETVHGVEFDFIPDVKGAVLVCDMSSNFLSKPVDVSKFGVIFAGAQKNVGSAGVTVVIVRDDLLGFALRECPSVLEYKVQAGNSSLYNTPPCFSIYVMGLVLEWIKNNGGAAAMEKLSSIKSQTIYEIIDNSQGFYVCPVEPQNRSKMNIPFRIGNAKGDDALEKRFLDKALELNMLSLKGHRSVGGIRASLYNAVTIEDVQKLAAFMKKFLEMHQL

• Full Name: phosphoserine aminotransferase 1
• Calculated Molecular Weight: 370 aa, 40 kDa
• Observed Molecular Weight: 37-40 kDa
• GenBank Accession Number: BC001618
• Gene Symbol: PSAT1
• Gene ID (NCBI): 29968
• RRID: AB_10665948
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y617
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PSAT1, also named as PSA and PSAT, belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family and SerC subfamily. It catalyzes the reversible conversion of 3-phosphohydroxypyruvate to phosphoserine and of 3-hydroxy-2-oxo-4-phosphonooxybutanoate to phosphohydroxythreonine. PSAT1 represents a new interesting target for CRC therapy. (PMID:18221502) It may be implicated in altered serine metabolism and schizophrenia spectrum conditions. (PMID:20955740 )

Publications

What published studies show

The PSAT1 antibody (Cat# 20180-1-AP) has 14 total citations spanning high-impact journals including Nature, Science, Nat Metab, Cancer Res, PNAS, EMBO Mol Med, EMBO Rep, eLife, Autophagy, Mol Metab, Br J Cancer, J Transl Med, Front Immunol, and BMC Cancer. Research fields center on serine biosynthesis, mTOR/ATF4 signaling, one-carbon metabolism, cancer metabolic reprogramming, autophagy, and tumor immune evasion in prostate, breast, gastric, lung, colorectal, and renal cancers.

Automatically generated from the 14 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Nature; Ageing promotes metastasis via activation of the integrated stress response; Authors - Angana A H Patel
		Science; mTORC1 induces purine synthesis through control of the mitochondrial tetrahydrofolate cycle.; Authors - Issam Ben-Sahra
human	WB	Nat Metab; Identifying strategies to target the metabolic flexibility of tumours.; Authors - Andrés Méndez-Lucas
human	WB	Cancer Res; Asparagine Dependency is a Targetable Metabolic Vulnerability in TP53-Altered Castration-Resistant Prostate Cancer; Authors - Young A Yoo
mouse	WB	Autophagy; Autophagy dictates PHGDH-mediated serine metabolism in a timely manner to support oocyte development.; Authors - Hainan He ; KD Validated
human	IHC	J Transl Med; SNHG12 drives gastric cancer progression by activating the Wnt/β-catenin-mediated serine synthesis pathway.; Authors - Nianjie Zhang