PSMA1 Monoclonal antibody, PBS Only

• 

  WB analysis using 67910-1-Ig (same clone as 67910-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67910-1-Ig (PSMA1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated Beta Actin Monoclonal antibody (HRP-66009) as loading control. This data was developed using the same antibody clone with 67910-1-PBS in a different storage buffer formulation.

• 

  WB analysis of RAW 264.7 using 67910-1-Ig (same clone as 67910-1-PBS)

  RAW 264.7 cells were subjected to SDS PAGE followed by western blot with 67910-1-Ig (PSMA1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67910-1-PBS in a different storage buffer formulation.

• 

  WB analysis of 4T1 using 67910-1-Ig (same clone as 67910-1-PBS)

  4T1 cells were subjected to SDS PAGE followed by western blot with 67910-1-Ig (PSMA1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67910-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 67910-1-Ig (same clone as 67910-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 67910-1-Ig (PSMA1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67910-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 67910-1-Ig (same clone as 67910-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 67910-1-Ig (PSMA1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67910-1-PBS in a different storage buffer formulation.

PSMA1 Monoclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 67910-1-PBS

Clone No.1D1D5

Host / Isotype

Mouse / IgG2b

Reactivity

Human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

30 kDa prosomal protein, HC2, Macropain subunit C2, NU, PROS 30, PROS30, Proteasome component C2, Proteasome nu chain, PSC2, PSMA1

---

Product Information

67910-1-PBS targets PSMA1 in WB, IHC, Indirect ELISA applications and shows reactivity with Human, mouse, rat samples.

• Tested Reactivity: Human, mouse, rat
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30527

  Product name: Recombinant human PSMA1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-263 aa of BC015105

  Sequence: MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQKKILHVDNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPTQRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCRAMSIGARSQSARTYLERHMSEFMECNLNELVKHGLRALRETLPAEQDLTTKNVSIGIVGKDLEFTIYDDDDVSPFLEGLEERPQRKAQPAQPADEPAEKADEPMEH

• Full Name: proteasome (prosome, macropain) subunit, alpha type, 1
• Calculated Molecular Weight: 30 kDa
• Observed Molecular Weight: 29-33 kDa
• GenBank Accession Number: BC015105
• Gene Symbol: PSMA1
• Gene ID (NCBI): 5682
• RRID: AB_2918665
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P25786
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PSMA1(Proteasome subunit alpha type-1) is also named as HC2, NU, PROS30, PSC2 and belongs to the peptidase T1A family.The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH.It is induced in breast cancer tissue and up-regulated in liver tumor tissues(PMID:17127214;16317774;17004105).