PSMD14/POH1 Polyclonal antibody

• 

  WB analysis using 12059-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 12059-1-AP (PSMD14/POH1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat heart using 12059-1-AP

  rat heart tissue were subjected to SDS PAGE followed by western blot with 12059-1-AP (PSMD14/POH1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A431 using 12059-1-AP

  WB result of PSMD14/POH1 antibody (12059-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-PSMD14/POH1 transfected A431 cells.

• 

  WB analysis using 12059-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 12059-1-AP (PSMD14/POH1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of K-562 using 12059-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 12059-1-AP (PSMD14/POH1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human colon cancer using 12059-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer using 12059-1-AP (PSMD14/POH1 antibody) at dilution of 1:50 (under 10x lens).

• 

  IF Staining of A375 using 12059-1-AP

  Immunofluorescent analysis of (4% PFA) fixed A375 cells using PSMD14/POH1 antibody (12059-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red).

• Featured Product
• KD/KO Validated

PSMD14/POH1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 12059-1-AP

Publications(13)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

PSMD14, 26S proteasome non-ATPase regulatory subunit 14, 26S proteasome-associated PAD1 homolog 1, EC:3.4.19.-, PAD1

---

Tested Applications

• Positive WB detected in: A431 cells, BT-549 cells, K-562 cells, rat heart tissue, HeLa cells, MCF-7 cells, MCF-10A cells, MDA-MB-231 cells, MDA-MB-468 cells
• Positive IHC detected in: human colon cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A375 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 6 publications below
• WB: See 13 publications below
• IHC: See 6 publications below
• IF: See 4 publications below

Product Information

12059-1-AP targets PSMD14/POH1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2694

  Product name: Recombinant human PSMD14 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-95 aa of BC009524

  Sequence: MLLNLHKKSWMEGLTLQDYSEHCKHNESVVKEMLELAKNYNKAVEEEDKMTPEQLAIKNVGKQDPKRHLEEHVDVLMTSNIVQCLAAMLDTVVFK

• Full Name: proteasome (prosome, macropain) 26S subunit, non-ATPase, 14
• Calculated Molecular Weight: 35 kDa
• Observed Molecular Weight: 35 kDa
• GenBank Accession Number: BC009524
• Gene Symbol: PSMD14
• Gene ID (NCBI): 10213
• RRID: AB_2170454
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O00487
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The PSMD14 (POH1, also known as Rpn11/MPR1/S13/CepP1) protein is a metalloprotease component of the 26S proteasome that specifically cleaves 'Lys-63'-linked polyubiquitin chains. The 26S proteasome is involved in the ATP-dependent degradation of ubiquitinated proteins. PSMD14 is highly expressed in the heart and skeletal muscle. In carcinoma cell lines. down-regulation of PSMD14 by siRNA transfection had a considerable impact on cell viability causing cell arrest in the G0-G1 phase, ultimately leading to senescence.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Cell Metab; Amelioration of nonalcoholic fatty liver disease by inhibiting the deubiquitylating enzyme RPN11; Authors - Bing Zhou
human	WB,IF	Sci Transl Med; Neutrophil extracellular traps, B cells, and type I interferons contribute to immune dysregulation in hidradenitis suppurativa.; Authors - Angel S Byrd
human	WB,IHC,IF	Nat Commun; POH1 deubiquitylates and stabilizes E2F1 to promote tumour formation.; Authors - Boshi Wang ; KD Validated
human	WB,IHC	Cancer Lett; POH1 induces Smad3 deubiquitination and promotes lung cancer metastasis; Authors - Yang Yuan ; KD Validated
human	WB	Theranostics; Blockade of deubiquitinating enzyme PSMD14 overcomes chemoresistance in head and neck squamous cell carcinoma by antagonizing E2F1/Akt/SOX2-mediated stemness.; Authors - Chao Jing ; KD Validated
human	WB,IF	Theranostics; The PSMD14 inhibitor Thiolutin as a novel therapeutic approach for esophageal squamous cell carcinoma through facilitating SNAIL degradation.; Authors - Chao Jing