PSMD14/POH1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• PSMD14/POH1 Polyclonal antibody (12059-1-AP)

• Featured Product
• KD/KO Validated

PSMD14/POH1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 12059-1-AP Copied!

Publications (21)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

PSMD14, 26S proteasome non-ATPase regulatory subunit 14, 26S proteasome-associated PAD1 homolog 1, EC:3.4.19.-, PAD1

• 

  WB analysis using 12059-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 12059-1-AP (PSMD14/POH1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of rat heart using 12059-1-AP

  rat heart tissue were subjected to SDS PAGE followed by western blot with 12059-1-AP (PSMD14/POH1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of A431 using 12059-1-AP

  WB result of PSMD14/POH1 antibody (12059-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-PSMD14/POH1 transfected A431 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 12059-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 12059-1-AP (PSMD14/POH1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of K-562 using 12059-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 12059-1-AP (PSMD14/POH1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 12059-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer using 12059-1-AP (PSMD14/POH1 antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of A375 using 12059-1-AP

  Immunofluorescent analysis of (4% PFA) fixed A375 cells using PSMD14/POH1 antibody (12059-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for PSMD14/POH1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: A431 cells, BT-549 cells, K-562 cells, rat heart tissue, HeLa cells, MCF-7 cells, MCF-10A cells, MDA-MB-231 cells, MDA-MB-468 cells
• Positive IHC detected in: human colon cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A375 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

12059-1-AP targets PSMD14/POH1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2694

  Product name: Recombinant human PSMD14 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-95 aa of BC009524

  Sequence: MLLNLHKKSWMEGLTLQDYSEHCKHNESVVKEMLELAKNYNKAVEEEDKMTPEQLAIKNVGKQDPKRHLEEHVDVLMTSNIVQCLAAMLDTVVFK

• Full Name: proteasome (prosome, macropain) 26S subunit, non-ATPase, 14
• Calculated Molecular Weight: 35 kDa
• Observed Molecular Weight: 35 kDa
• GenBank Accession Number: BC009524
• Gene Symbol: PSMD14
• Gene ID (NCBI): 10213
• RRID: AB_2170454
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O00487
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The PSMD14 (POH1, also known as Rpn11/MPR1/S13/CepP1) protein is a metalloprotease component of the 26S proteasome that specifically cleaves 'Lys-63'-linked polyubiquitin chains. The 26S proteasome is involved in the ATP-dependent degradation of ubiquitinated proteins. PSMD14 is highly expressed in the heart and skeletal muscle. In carcinoma cell lines. down-regulation of PSMD14 by siRNA transfection had a considerable impact on cell viability causing cell arrest in the G0-G1 phase, ultimately leading to senescence.

Publications

What published studies show

The PSMD14/POH1 Polyclonal antibody (Cat# 12059-1-AP) has 21 citations published in journals including Nature Communications, Science Translational Medicine, Theranostics, Cell Metabolism, Science Advances, Cell Death & Differentiation, Oncogene, and Cancer Letters. Associated research fields encompass proteasomal deubiquitination, cancer biology (lung, breast, ovarian, gastric, pancreatic, bladder, and thyroid cancers), immune dysregulation, lipid metabolism, histone lactylation, autophagy, and nonalcoholic fatty liver disease.

Automatically generated from the 21 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Cell Metab; Amelioration of nonalcoholic fatty liver disease by inhibiting the deubiquitylating enzyme RPN11; Authors - Bing Zhou
human	WB,IHC,IF	Nat Commun; POH1 deubiquitylates and stabilizes E2F1 to promote tumour formation.; Authors - Boshi Wang ; KD Validated
human	WB,IF	Sci Transl Med; Neutrophil extracellular traps, B cells, and type I interferons contribute to immune dysregulation in hidradenitis suppurativa.; Authors - Angel S Byrd
human	WB,IF	Theranostics; The PSMD14 inhibitor Thiolutin as a novel therapeutic approach for esophageal squamous cell carcinoma through facilitating SNAIL degradation.; Authors - Chao Jing
human	WB	Theranostics; Blockade of deubiquitinating enzyme PSMD14 overcomes chemoresistance in head and neck squamous cell carcinoma by antagonizing E2F1/Akt/SOX2-mediated stemness.; Authors - Chao Jing ; KD Validated
human	WB	J Biomed Sci; PPM1D is directly degraded by proteasomes in a ubiquitination-independent manner through its carboxyl-terminal region.; Authors - Masaki Takahashi