PSMG1 Monoclonal antibody

• 

  WB analysis of Jurkat using 60048-1-Ig

  Jurkat cells were subjected to SDS PAGE followed by western blot with 60048-1-Ig (PSMG1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

PSMG1 Monoclonal Antibody for ELISA

Cat No. 60048-1-Ig

Clone No.1B6E1

Host / Isotype

Mouse / IgM

Reactivity

human

Applications

ELISA

Synonyms

---

Product Information

60048-1-Ig targets PSMG1 in ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgM
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0303

  Product name: Recombinant human PSMG1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 92-249 aa of BC003619

  Sequence: VWEEVGCAKLWNEWCRTTDTTHLSSTEAFCVFYHLKSNPSVFLCQCSCYVAEDQQYQWLEKVFGSCPRKNMQITILTCRHVTDYKTSESTGSLPSPFLRALKTQNFKDSACCPLLEQPNIVHDLPAAVLSYCQVWKIPAILYLCYTDVMKLDLITVEA

• Full Name: proteasome (prosome, macropain) assembly chaperone 1
• Calculated Molecular Weight: 288 aa, 33 kDa
• Observed Molecular Weight: 44 kDa
• GenBank Accession Number: BC003619
• Gene Symbol: PSMG1
• Gene ID (NCBI): 8624
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Thiophilic affinity chromatograph
• UNIPROT ID: O95456
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.