PTF1A Polyclonal antibody

• 

  WB analysis using 30987-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 30987-1-AP (PTF1A antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

PTF1A Polyclonal Antibody for WB, ELISA

Cat No. 30987-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat, human

Applications

WB, ELISA

Synonyms

bHLH transcription factor p48, bHLHa29, PTF1 p48, PTF1A, PTF1P48

---

Tested Applications

• Positive WB detected in: mouse pancreas tissue, rat pancreas

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

30987-1-AP targets PTF1A in WB, ELISA applications and shows reactivity with mouse, rat, human samples.

• Tested Reactivity: mouse, rat, human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag34321

  Product name: Recombinant human PTF1A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 155-328 aa of NM_178161

  Sequence: VRSEAELQQLRQAANVRERRRMQSINDAFEGLRSHIPTLPYEKRLSKVDTLRLAIGYINFLSELVQADLPLRGGGAGGCGGPGGGGRLGGDSPGSQAQKVIICHRGTRSPSPSDPDYGLPPLAGHSLSWTDEKQLKEQNIIRTAKVWTPEDPRKLNSKSSFNNIENEPPFEFVS

• Full Name: pancreas specific transcription factor, 1a
• Calculated Molecular Weight: 35 kDa
• Observed Molecular Weight: 40 kDa
• GenBank Accession Number: NM_178161
• Gene Symbol: PTF1A
• Gene ID (NCBI): 256297
• RRID: AB_3669807
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q7RTS3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.