Product Information
84960-1-PBS targets PTH in Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Eg3191 Product name: Recombinant Human PTH protein (rFc Tag)(HPLC verified) Source: mammalian cells-derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 32-115 aa of NM_000315.4 Sequence: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ Predict reactive species |
| Full Name | parathyroid hormone |
| Calculated Molecular Weight | 13kDa |
| GenBank Accession Number | NM_000315.4 |
| Gene Symbol | PTH |
| Gene ID (NCBI) | 5741 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P01270 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
