PTH2R Polyclonal antibody

• 

  WB analysis of L02 using 14166-1-AP

  L02 cells were subjected to SDS PAGE followed by western blot with 14166-1-AP (PTH2R antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse testis using 14166-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 14166-1-AP (PTH2R antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse pancreas using 14166-1-AP

  mouse pancreas tissue were subjected to SDS PAGE followed by western blot with 14166-1-AP (PTH2R antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse liver using 14166-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 14166-1-AP (PTH2R antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of BxPC-3 using 14166-1-AP

  BxPC-3 cells were subjected to SDS PAGE followed by western blot with 14166-1-AP (PTH2R antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human testis using 14166-1-AP

  human testis tissue were subjected to SDS PAGE followed by western blot with 14166-1-AP (PTH2R antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human pancreas cancer using 14166-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer using 14166-1-AP (PTH2R antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human pancreas cancer using 14166-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer using 14166-1-AP (PTH2R antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human renal cell carcinoma using 14166-1-AP

  Immunohistochemical analysis of paraffin-embedded human renal cell carcinoma using 14166-1-AP (PTH2R antibody) at dilution of 1:25 (under 10x lens).

• 

  IHC staining of human renal cell carcinoma using 14166-1-AP

  Immunohistochemical analysis of paraffin-embedded human renal cell carcinoma using 14166-1-AP (PTH2R antibody) at dilution of 1:25 (under 40x lens).

• 

  IHC staining of human renal cell carcinoma using 14166-1-AP

  Immunohistochemical analysis of paraffin-embedded human renal cell carcinoma using 14166-1-AP (PTH2R antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human renal cell carcinoma using 14166-1-AP

  Immunohistochemical analysis of paraffin-embedded human renal cell carcinoma using 14166-1-AP (PTH2R antibody) at dilution of 1:50 (under 40x lens).

• 

  FC experiment of BxPC-3 using 14166-1-AP

  1x10^6 BxPC-3 cells were intracellularly stained with 0.4 ug PTH2R Polyclonal antibody (14166-1-AP) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.4 ug rabbit IgG isotype control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C).

PTH2R Polyclonal Antibody for WB, IHC, ELISA

Cat No. 14166-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

parathyroid hormone 2 receptor, PTH2 receptor, PTHR2

---

Tested Applications

• Positive WB detected in: L02 cells, BxPC-3 cells, human testis tissue, mouse liver tissue, mouse pancreas tissue, mouse testis tissue
• Positive IHC detected in: human pancreas cancer tissue, human renal cell carcinoma tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive FC (Intra) detected in: BxPC-3 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

14166-1-AP targets PTH2R in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5364

  Product name: Recombinant human PTH2R protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 419-550 aa of BC036811

  Sequence: EVQAEVKKMWSRWNLSVDWKRTPPCGSRRCGSVLTTVTHSTSSQSQVAASTRMVLISGKAAKIASRQPDSHITLPGYVWSNSEQDCLPHSFHEETKEDSGRQGDDILMEKPSRPMESNPDTEGCQGETEDVL

• Full Name: parathyroid hormone 2 receptor
• Calculated Molecular Weight: 550 aa, 62 kDa
• Observed Molecular Weight: 62-66 kDa
• GenBank Accession Number: BC036811
• Gene Symbol: PTH2R
• Gene ID (NCBI): 5746
• RRID: AB_2253212
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P49190
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Parathyroid hormone 2 receptor (PTH2R, also known as PTHR2) is a member of the secretin receptor family of G protein-coupled receptors. PTH2R selectively recognizes parathyroid hormone and is particularly abundant in the brain and pancreas (PMID: 7797535). Tuberoinfundibular peptide of 39 residues (TIP39) is the endogenous ligand of the PTH2R in the brain, and they form a neuromodulator system (PMID: 19857544). PTH2R is involved in the regulation of calcium transport, nociception mediation, and wound healing (PMID: 34353904).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Int J Hematol; Neuropeptide TIP39 induces autophagy in PTH2 receptor-positive myeloid neoplasms; Authors - Kento Ono