PTK7/CCK4 Polyclonal antibody

• 

  WB analysis using 17799-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 17799-1-AP (PTK7 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of PaTu 8988s using 17799-1-AP

  WB result of PTK7 antibody (17799-1-AP; 1:2000; room temperature for 1.5 hours) with wild-type and PTK7 knockout PaTu 8988s cells.

• 

  WB analysis of Jurkat using 17799-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 17799-1-AP (PTK7 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A431 using 17799-1-AP

  A431 cells were subjected to SDS PAGE followed by western blot with 17799-1-AP (PTK7 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of Jurkat using 17799-1-AP

  IP result of anti-PTK7 (IP:17799-1-AP, 4ug; Detection:17799-1-AP 1:300) with Jurkat cells lysate 3400ug.

• 

  IHC staining of human colon cancer using 17799-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 17799-1-AP (PTK7 antibody) at dilution of 1:1600 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon cancer using 17799-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 17799-1-AP (PTK7 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon cancer using 17799-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 17799-1-AP (PTK7 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

PTK7/CCK4 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 17799-1-AP

Publications(10)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, IP, ELISA

Synonyms

PTK7, Protein tyrosine kinase 7, Inactive tyrosine-protein kinase 7, Colon carcinoma kinase 4, CCK-4

---

Tested Applications

• Positive WB detected in: PC-12 cells, A431 cells, Jurkat cells, PaTu 8988s cells
• Positive IP detected in: Jurkat cells
• Positive IHC detected in: human colon cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:800-1:3200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 5 publications below
• IHC: See 3 publications below
• IF: See 4 publications below
• IP: See 1 publications below

Product Information

17799-1-AP targets PTK7/CCK4 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12004

  Product name: Recombinant human PTK7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 724-1070 aa of BC071557

  Sequence: FYCKKRCKAKRLQKQPEGEEPEMECLNGGPLQNGQPSAEIQEEVALTSLGSGPAATNKRHSTSDKMHFPRSSLQPITTLGKSEFGEVFLAKAQGLEEGVAETLVLVKSLQSKDEQQQLDFRRELEMFGKLNHANVVRLLGLCREAEPHYMVLEYVDLGDLKQFLRISKSKDEKLKSQPLSTKQKVALCTQVALGMEHLSNNRFVHKDLAARNCLVSAQRQVKVSALGLSKDVYNSEYYHFRQAWVPLRWMSPEAILEGDFSTKSDVWAFGVLMWEVFTHGEMPHGGQADDEVLADLQAGKARLPQPEGCPSKLYRLMQRCWALSPKDRPSFSEIASALGDSTVDSKP

• Full Name: PTK7 protein tyrosine kinase 7
• Calculated Molecular Weight: 1070 aa, 118 kDa
• Observed Molecular Weight: 140-150 kDa
• GenBank Accession Number: BC071557
• Gene Symbol: PTK7
• Gene ID (NCBI): 5754
• RRID: AB_2878442
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13308
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Protein tyrosine kinase 7 (PTK7), also known as colon carcinoma kinase 4 (CCK4), is an atypical receptor tyrosine kinase that consists of an extracellular domain with seven immunoglobulin-like domains, a transmembrane domain, and a catalytically defective tyrosine kinase domain (PMID: 29867084). It is implicated in planar cell polarity and in the Wnt canonical and non-canonical pathways (PMID: 24618420). Overexpression of PTK7 has been reported in a variety of tumors, such as cervical cancer, colon cancer, lung adenocarcinoma, acute myelogenous leukemia, and gastric cancer (PMID: 30944666).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
Human	WB,IP,IHC,IF	Cell Death Dis; Periostin secreted by cancer-associated fibroblasts promotes cancer stemness in head and neck cancer by activating protein tyrosine kinase 7.; Authors - Binbin Yu
human	IHC	Mod Pathol; USCAP 2018 Abstracts: Techniques (2229-2304).; Authors - W. D. Mojica
mouse	WB	Life Sci; Identification of metastasis-related genes by genomic and transcriptomic studies in murine melanoma.; Authors - Onat Kadioglu
human	WB	Med Sci Monit; Bioinformatics Analysis Identifies Protein Tyrosine Kinase 7 (PTK7) as a Potential Prognostic and Therapeutic Biomarker in Stages I to IV Hepatocellular Carcinoma.; Authors - Ren-Chao Zou
human	IHC	Clin Exp Dent Res; High expression of protein tyrosine kinase 7 in oral squamous cell carcinoma: Clinicopathological correlation and prognosis relevance.; Authors - Yujiro Kimura
mouse	IF	Cell Rep; Phosphatidylinositol transfer protein/planar cell polarity axis regulates neocortical morphogenesis by supporting interkinetic nuclear migration.; Authors - Zhigang Xie

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Gabriel (Verified Customer) (01-15-2019)

• Applications: Immunoprecipitation,
• Cell Tissue Type: MCF10A

PTK7/CCK4 Antibody Immunoprecipitation, validation ( dilution) in MCF10A (Cat no:17799-1-AP)