PTPN22 Polyclonal antibody

• 

  WB analysis using 11783-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11783-1-AP (PTPN22 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 11783-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 11783-1-AP (PTPN22 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 11783-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11783-1-AP (PTPN22 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  IP experiment of Jurkat using 11783-1-AP

  IP result of anti-PTPN22 (IP:11783-1-AP, 4ug; Detection:11783-1-AP 1:300) with Jurkat cells lysate 3080ug.

• 

  IHC staining of human lymphoma using 11783-1-AP

  Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 11783-1-AP (PTPN22 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

PTPN22 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 11783-1-AP

Publications(5)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (2)

Applications

WB, IHC, IF, IP, CoIP, ELISA

Synonyms

EC:3.1.3.48, Hematopoietic cell protein-tyrosine phosphatase 70Z-PEP, LyP, LYP1, LYP2

---

Tested Applications

• Positive WB detected in: Daudi cells, Raji cells, Jurkat cells
• Positive IP detected in: Jurkat cells
• Positive IHC detected in: human lymphoma tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 4 publications below
• IHC: See 1 publications below
• IF: See 1 publications below
• IP: See 1 publications below
• CoIP: See 1 publications below

Product Information

11783-1-AP targets PTPN22 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2397

  Product name: Recombinant human PTPN22 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-179 aa of BC017785

  Sequence: MDQREILQKFLDEAQSKKITKEEFANEFLKLKRQSTKYKADKTYPTTVAEKPKNIKKNRYKDILPYDYSRVELSLITSDEDSSYINANFIKGVYGPKAYIATQGPLSTTLLDFWRMIWEYSVLIIVMACMEYEMGKEAEKRKSDYIIRTLKVKFNSVSVILAHQTSLQNLFSQITPAHF

• Full Name: protein tyrosine phosphatase, non-receptor type 22 (lymphoid)
• Calculated Molecular Weight: 82 kDa, 92 kDa
• Observed Molecular Weight: 100-110 kDa
• GenBank Accession Number: BC017785
• Gene Symbol: PTPN22
• Gene ID (NCBI): 26191
• RRID: AB_2173378
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y2R2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PTPN22(Tyrosine-protein phosphatase non-receptor type 22) is also named as LyP,PEP,PTPN8.It belongs to the protein-tyrosine phosphatase family and non-receptor class 4 subfamily.It acts as negative regulator of T-cell receptor (TCR) signaling.Defects in PTPN22 are a cause of susceptibility to systemic lupus erythematosus (SLE). It has some isoforms produced by alternative splicing with calculated molecular mass of 79-92 kDa, and apparent molecular mass of 100-110 kDa.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	J Exp Med; NLR Nod1 signaling promotes survival of BCR-engaged mature B cells through up-regulated Nod1 as a positive outcome.; Authors - Kyoko Hayakawa
mouse	WB，IP	Sci Signal; The adaptor protein TRAF3 inhibits interleukin-6 receptor signaling in B cells to limit plasma cell development.; Authors - Wai W Lin
human	WB	Sci Rep; TRAF3 enhances TCR signaling by regulating the inhibitors Csk and PTPN22.; Authors - Alicia M Wallis
rat	IF	Pflugers Arch; Anandamide produced by Ca(2+)-insensitive enzymes induces excitation in primary sensory neurons.; Authors - Varga Angelika A
rat	WB,IHC,CoIP	J Adv Res; PTPN22 as a therapeutic target in intervertebral disc degeneration: Modulating mitophagy and pyroptosis through the PI3K/AKT/mTOR axis; Authors - Haibo Liang