PTS Polyclonal antibody, PBS Only

• 

  WB analysis of human brain using 12150-1-AP (same clone as 12150-1-PBS)

  human brain tissue were subjected to SDS PAGE followed by western blot with 12150-1-AP (PTS antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12150-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human gliomas using 12150-1-AP (same clone as 12150-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human gliomas using 12150-1-AP (PTS antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 12150-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 12150-1-AP (same clone as 12150-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using PTS antibody (12150-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 12150-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

PTS Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 12150-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

6-pyruvoyl tetrahydrobiopterin synthase, EC:4.2.3.12, PTP synthase, PTPS

---

Product Information

12150-1-PBS targets PTS in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2798

  Product name: Recombinant human PTS protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-145 aa of BC009686

  Sequence: MSTEGGGRRCQAQVSRRISFSASHRLYSKFLSDEENLKLFGKCNNPNGHGHNYKVVVTVHGEIDPATGMVMNLADLKKYMEEAIMQPLDHKNLDMDVPYFADVVSTTENVAVYIWDNLQKVLPVGVLYKVKVYETDNNIVVYKGE

• Full Name: 6-pyruvoyltetrahydropterin synthase
• Calculated Molecular Weight: 145 aa, 16 kDa
• Observed Molecular Weight: 16 kDa
• GenBank Accession Number: BC009686
• Gene Symbol: PTS
• Gene ID (NCBI): 5805
• RRID: AB_2173398
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q03393
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.