PYGL Monoclonal antibody, PBS Only

• 

  WB analysis of HSC-T6 using 66769-1-Ig (same clone as 66769-1-PBS)

  HSC-T6 cells were subjected to SDS PAGE followed by western blot with 66769-1-Ig (PYGL antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66769-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 66769-1-Ig (same clone as 66769-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66769-1-Ig (PYGL antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66769-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 66769-1-Ig (same clone as 66769-1-PBS)

  WB result of PYGL antibody (66769-1-Ig; 1:4000; incubated at room temperature for 1.5 hours) with sh-Control and sh-PYGL transfected HeLa cells. This data was developed using the same antibody clone with 66769-1-PBS in a different storage buffer formulation.

• 

  IF Staining of U-251 using 66769-1-Ig (same clone as 66769-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed U-251 cells using PYGL antibody (66769-1-Ig, Clone: 1G12D8 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66769-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

PYGL Monoclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 66769-1-PBS

Clone No.1G12D8

Host / Isotype

Mouse / IgG1

Reactivity

human, rat

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

Glycogen phosphorylase, liver form, EC:2.4.1.1, 1G12D8

---

Product Information

66769-1-PBS targets PYGL in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8550

  Product name: Recombinant human PYGL protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 499-846 aa of BC009895

  Sequence: GLAELIAEKIGEDYVKDLSQLTKLHSFLGDDVFLRELAKVKQENKLKFSQFLETEYKVKINPSSMFDVQVKRIHEYKRQLLNCLHVITMYNRIKKDPKKLFVPRTVIIGGKAAPGYHMAKMIIKLITSVADVVNNDPMVGSKLKVIFLENYRVSLAEKVIPATDLSEQISTAGTEASGTGNMKFLNGALTIGTMDGANVEMAEEAGEENLFIFGMRIDDVAALDKKGYEAKEYYEALPELKLVIDQIDNGFFSPKQPDLFKDIINMLFYHDRFKVFADYEAYVKCQDKVSQLYMNPKAWNTMVLKNIAASGKFSSDRTIKEYAQNIWNVEPSDLKISLSNESNKVNGN

• Full Name: phosphorylase, glycogen, liver
• Calculated Molecular Weight: 846 aa, 97 kDa
• Observed Molecular Weight: 97 kDa
• GenBank Accession Number: BC009895
• Gene Symbol: PYGL
• Gene ID (NCBI): 5836
• RRID: AB_2882115
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P06737
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Glycogen phosphorylase L (PYGL) is one of the gene related to hypoxia metabolism and was found to be up-regulated in head and neck squamous cell carcinomas (HNSCCs) and breast cancers. Glycogen synthases (GSs) and glycogen phosphorylases (GPs) catalyze the key steps of glycogen synthesis and breakdown, while glycogen phosphorylase has three isoforms: PYGM (muscle), PYGL (liver), and PYGB (brain) (PMID: 37063425, 9529348). High PYGL expression plays an independent role in predicting the poor prognosis of glioma patients (PMID: 34177761).