Placental lactogen Polyclonal antibody, PBS Only

• 

  WB analysis of human placenta using 10178-1-AP (same clone as 10178-1-PBS)

  human placenta tissue were subjected to SDS PAGE followed by western blot with 10178-1-AP (Placental lactogen antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10178-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human placenta using 10178-1-AP (same clone as 10178-1-PBS)

  human placenta tissue were subjected to SDS PAGE followed by western blot with 10178-1-AP (Placental lactogen antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10178-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 10178-1-AP (same clone as 10178-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 10178-1-AP (Placental lactogen antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10178-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 10178-1-AP (same clone as 10178-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 10178-1-AP (Placental lactogen antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10178-1-PBS in a different storage buffer formulation.

Placental lactogen Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 10178-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

10178-1-PBS targets Placental lactogen in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0201

  Product name: Recombinant human CSH1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 6-207 aa of BC002717

  Sequence: RTSLLLAFALLCLPWLQEAGAVQTVPLSRLFDHAMLQAHRAHQLAIDTYQEFEETYIPKDQKYSFLHDSQTSFCFSDSIPTPSNMEETQQKSNLELLRISLLLIESWLEPVRFLRSMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYSKFDTNSHNHDALLKNYGLLYCFRKDMDKVETFLRMVQ

• Full Name: chorionic somatomammotropin hormone 1 (placental lactogen)
• Calculated Molecular Weight: 25 kDa
• Observed Molecular Weight: 22-25 kDa
• GenBank Accession Number: BC002717
• Gene Symbol: CSH1
• Gene ID (NCBI): 1442
• RRID: AB_2083884
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P0DML2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Chorionic somatomammotropin hormone 1 (placental lactogen, CSH1), is a hormone with the molecular weight of 25 kDa. The data suggest that this protein may link with the Silver-Russell syndrome (SRS), a disease of pre- and postnatal growth restriction and a characteristic small, triangular face. SRS is also accompanied by other dysmorphic features including fifth finger clinodactyly and skeletal asymmetry.