Podoplanin Polyclonal antibody, PBS Only

• 

  WB analysis of human brain using 22099-1-AP (same clone as 22099-1-PBS)

  human brain tissue were subjected to SDS PAGE followed by western blot with 22099-1-AP (Podoplanin antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 22099-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human brain using 22099-1-AP (same clone as 22099-1-PBS)

  human brain tissue were subjected to SDS PAGE followed by western blot with 22099-1-AP (Podoplanin antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 22099-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human placenta using 22099-1-AP (same clone as 22099-1-PBS)

  human placenta tissue were subjected to SDS PAGE followed by western blot with 22099-1-AP (Podoplanin antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 22099-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human appendicitis using 22099-1-AP (same clone as 22099-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human appendicitis tissue slide using 22099-1-AP (Podoplanin antibody) at dilution of 1:4000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 22099-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human appendicitis using 22099-1-AP (same clone as 22099-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human appendicitis tissue slide using 22099-1-AP (Podoplanin antibody) at dilution of 1:4000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 22099-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lymphoma using 22099-1-AP (same clone as 22099-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 22099-1-AP (Podoplanin antibody) at dilution of 1:4000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 22099-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lymphoma using 22099-1-AP (same clone as 22099-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 22099-1-AP (Podoplanin antibody) at dilution of 1:4000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 22099-1-PBS in a different storage buffer formulation.

• 

  IF Staining of human placenta using 22099-1-AP (same clone as 22099-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human placenta tissue using Podoplanin antibody (22099-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 22099-1-PBS in a different storage buffer formulation.

• 

  IF Staining of human placenta using 22099-1-AP (same clone as 22099-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human placenta tissue using Podoplanin antibody (22099-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 22099-1-PBS in a different storage buffer formulation.

Podoplanin Polyclonal Antibody for WB, IHC, IF-P, Indirect ELISA

Cat No. 22099-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF-P, Indirect ELISA

Synonyms

PDPN, PSEC0003, PA2.26 antigen, Aggrus, 29kDa cytosolic podoplanin intracellular domain

---

Product Information

22099-1-PBS targets Podoplanin in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17307

  Product name: Recombinant human PDPN protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 101-238 aa of BC022812

  Sequence: TGQPEDDTETTGLEGGVAMPGAEDDVVTPGTSEDRYKSGLTTLVATSVNSVTGIRIEDLPTSESTVHAQEQSPSATASNVATSHSTEKVDGDTQTTVEKDGLSTVTLVGIIVGVLLAIGFIGGIIVVVMRKMSGRYSP

• Full Name: podoplanin
• Calculated Molecular Weight: 238 aa, 25 kDa
• Observed Molecular Weight: 43 kDa
• GenBank Accession Number: BC022812
• Gene Symbol: Podoplanin
• Gene ID (NCBI): 10630
• RRID: AB_2878995
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q86YL7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.