Podoplanin Polyclonal antibody

• 

  WB analysis using 33099-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 33099-1-AP (Podoplanin antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse lung using 33099-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 33099-1-AP (Podoplanin antibody) at dilution of 1:800 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse lung using 33099-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 33099-1-AP (Podoplanin antibody) at dilution of 1:800 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse kidney using 33099-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 33099-1-AP (Podoplanin antibody) at dilution of 1:800 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse kidney using 33099-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 33099-1-AP (Podoplanin antibody) at dilution of 1:800 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

Podoplanin Polyclonal Antibody for WB, IHC, ELISA

Cat No. 33099-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

WB, IHC, ELISA

Synonyms

E11, Glycoprotein 38, Gp38, Ots8, OTS-8

---

Tested Applications

• Positive WB detected in: C2C12 cells, NIH?3T3 cells, RAW 264.7 cells
• Positive IHC detected in: mouse lung tissue, mouse kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunohistochemistry (IHC): IHC : 1:400-1:1600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

33099-1-AP targets Podoplanin in WB, IHC, ELISA applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Eg2861

  Product name: Recombinant Mouse Podoplanin/PDPN protein (rFc Tag)(HPLC verified)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 21-133 aa of NM_010329.3

  Sequence: QGGTIGVNEDDIVTPGTGDGMVPPGIEDKITTTGATGGLNESTGKAPLVPTQRERGTKPPLEELSTSATSDHDHREHESTTTVKVVTSHSVDKKTSHPNRDNAGDETQTTDKK

• Full Name: podoplanin
• Calculated Molecular Weight: 18 kDa
• Observed Molecular Weight: 38-40 kDa
• GenBank Accession Number: NM_010329.3
• Gene Symbol: Pdpn
• Gene ID (NCBI): 14726
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q62011
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Podoplanin was identified as a glycoprotein found in the cell membranes of glomerular epithelial cells (podocyte) (PMID: 9327748). It is a lymphatic marker because the expression of podoplanin has been detected in lymphatic but not blood vascular endothelium, and is useful as the marker of tumor-associated Lymphangiogenesis. Podoplanin has a function in developing testis, most likely at the level of cell-cell interactions among pre-meiotic germ cells and immature Sertoli cells. It may be involved in cell migration and/or actin cytoskeleton organization. When expressed in keratinocytes, PDPN induces changes in cell morphology with transfected cells showing an elongated shape, numerous membrane protrusions, major reorganization of the actin cytoskeleton, increased motility and decreased cell adhesion. It is required for normal lung cell proliferation and alveolus formation at birth. PDPN induces platelet aggregation. It does not have any effect on folic acid or amino acid transport and does not function as a water channel or as a regulator of aquaporin-type water channels.