Prion protein PrP/CD230 Recombinant monoclonal antibody, PBS Only

Prion protein PrP/CD230 Uni-rAb® Recombinant Antibody for WB, Indirect ELISA
Cat No. 85611-4-PBS
Clone No.243104D11

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Prion protein PrP, PRNP, PrP, Alternative prion protein, AltPrP

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

85611-4-PBS targets Prion protein PrP/CD230 in WB, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg3359

Product name: Recombinant Human Prion protein PrP protein (rFc Tag)

Source: mammalian cells-derived, pHZ-KIsec-C-rFc

Tag: C-rFc

Domain: 23-229 aa of BC012844

Sequence: KKRPKPGGWNTGGSRYPGQGSPGGNRYPPQGGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQGGGTHSQWNKPSKPKTNMKHMAGAAAAGAVVGGLGGYMLGSAMSRPIIHFGSDYEDRYYRENMHRYPNQVYYRPMDEYSNQNNFVHDCVNITIKQHTVTTTTKGENFTETDVKMMERVVEQMCITQYERESQAYYQRG

Predict reactive species
Full Name prion protein
Observed Molecular Weight 20-35 kDa
GenBank Accession NumberBC012844
Gene Symbol PrP
Gene ID (NCBI) 5621
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP04156
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Prion protein (PRNP) is a ubiquitous membrane glycoprotein whose abnormal self-replicating, misfolded form is widely believed to cause several central nervous system disorders, collectively known as Transmissible Spongiform Encephalopathies (TSE). Prion diseases are TSEs, attributed to conformational conversion of the cellular prion protein (PrPC) into an abnormal conformer that accumulates in the brain. The two isoforms, PrPC and PrPS, have the same primary amino acid sequence and only differ in conformation. While PrPC is composed of 42% α-helix and only 3% β-sheet, PrPSc is composed of 30% α-helix and 43% β-sheet. PrPC converts to its pathogenic isoform when the region corresponding to the residues 108-144 fold into β-sheets. PrPC is very soluble in detergents and easily digested by proteases while the PrPSc is insoluble in detergents and resistant to protease digestion. Prion diseases exist in infectious, sporadic, and genetic forms.

Loading...
||
New chat

Able

正在加载,请稍候...