RAB34 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 86839-3-RR (same clone as 86839-3-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86839-3-RR (RAB34 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86839-3-PBS in a different storage buffer formulation.

RAB34 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 86839-3-PBS

Clone No.251867B8

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

RAB39, RAH, Ras related protein Rab 34, Ras related protein Rab 39, Ras related protein Rah

---

Product Information

86839-3-PBS targets RAB34 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag26696

  Product name: Recombinant human RAB34 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 126-251 aa of BC016841

  Sequence: QAIIIVFNLNDVASLEHTKQWLADALKENDPSSVLLFLTPAQYALMEKDALQVAQEMKAEYWAVSSLTGENVREFFFRVAALTFEANVLAELEKSGARRIGDVVRINSDDSNLYLTASKKKPTCCP

• Full Name: RAB34, member RAS oncogene family
• Calculated Molecular Weight: 251 aa, 28 kDa
• Observed Molecular Weight: 29 kDa
• GenBank Accession Number: BC016841
• Gene Symbol: RAB34
• Gene ID (NCBI): 83871
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9BZG1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

RAB34, a Rab protein family member, is involved in repositioning of lysosomes, activation of micropinocytosis, and protein transport. RAB34 is aberrantly expressed in various cancers and exhibits oncogenic properties. Recently, Rab34 is identified as a ciliary protein. Rab34 is required for internal assembly of cilia but not for cilia built on the cell surface.