RAB8 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• RAB8 Polyclonal antibody (11792-1-AP)

• Featured Product
• KD/KO Validated

RAB8 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 11792-1-AP Copied!

Publications (10)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

RAB8B, Ras related protein Rab 8B, Ras-related protein Rab-8B

• 

  WB analysis of fetal human brain using 11792-1-AP

  fetal human brain tissue were subjected to SDS PAGE followed by western blot with 11792-1-AP (RAB8B Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of fetal human brain using 11792-1-AP

  fetal human brain tissue were subjected to SDS PAGE followed by western blot with 11792-1-AP (RAB8B Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human brain using 11792-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 11792-1-AP (RAB8B antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of mouse brain using 11792-1-AP

  IP result of anti-RAB8 (IP:11792-1-AP, 4ug; Detection:11792-1-AP 1:1000) with mouse brain tissue lysate 4000ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 11792-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 11792-1-AP (RAB8 antibody) at dilution of 1:800 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 11792-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 11792-1-AP (RAB8 antibody) at dilution of 1:800 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 11792-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 11792-1-AP (RAB8 antibody) at dilution of 1:800 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat brain using 11792-1-AP

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 11792-1-AP (RAB8 antibody) at dilution of 1:800 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat brain using 11792-1-AP

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 11792-1-AP (RAB8 antibody) at dilution of 1:800 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 11792-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 11792-1-AP (RAB8B antibody) at dilution of 1:200 (under 10x lens) Heat mediated antigen retrieved with Sodium Citrate buffer (pH 6.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 11792-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 11792-1-AP (RAB8B antibody) at dilution of 1:200 (under 40x lens) Heat mediated antigen retrieved with Sodium Citrate buffer (pH 6.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse thymus using 11792-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse thymus tissue slide using 11792-1-AP (RAB8 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human rectal cancer using 11792-1-AP

  Immunohistochemical analysis of paraffin-embedded human rectal cancer tissue slide using 11792-1-AP (RAB8 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse ovary using 11792-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse ovary tissue slide using 11792-1-AP (RAB8 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human placenta using 11792-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 11792-1-AP (RAB8 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human rectal cancer using 11792-1-AP

  Immunohistochemical analysis of paraffin-embedded human rectal cancer tissue slide using 11792-1-AP (RAB8 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse ovary using 11792-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse ovary tissue slide using 11792-1-AP (RAB8 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse spleen using 11792-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 11792-1-AP (RAB8 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat spleen using 11792-1-AP

  Immunohistochemical analysis of paraffin-embedded rat spleen tissue slide using 11792-1-AP (RAB8 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat thymus using 11792-1-AP

  Immunohistochemical analysis of paraffin-embedded rat thymus tissue slide using 11792-1-AP (RAB8 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 11792-1-AP

  Immunofluorescent analysis of (-20℃ Ethanol) fixed HepG2 cells using 11792-1-AP (RAB8B antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for RAB8 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: fetal human brain tissue, human brain tissue
• Positive IP detected in: mouse brain tissue
• Positive IHC detected in: mouse brain tissue, human lung cancer tissue, mouse thymus tissue, human placenta tissue, human rectal cancer tissue, mouse ovary tissue, mouse spleen tissue, rat spleen tissue, rat thymus tissue, rat brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:400-1:1600
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

11792-1-AP targets RAB8 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, canine
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2421

  Product name: Recombinant human RAB8B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-207 aa of BC020654

  Sequence: MAKTYDYLFKLLLIGDSGVGKTCLLFRFSEDAFNTTFISTIGIDFKIRTIELDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIKNWIRNIEEHASSDVERMILGNKCDMNDKRQVSKERGEKLAIDYGIKFLETSAKSSANVEEAFFTLARDIMTKLNRKMNDSNSAGAGGPVKITENRSKKTSFFRCSLL

• Full Name: RAB8B, member RAS oncogene family
• Calculated Molecular Weight: 207 aa, 24 kDa
• Observed Molecular Weight: 24 kDa
• GenBank Accession Number: BC020654
• Gene Symbol: RAB8B
• Gene ID (NCBI): 51762
• RRID: AB_2253392
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q92930
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The Rab8 GTPase is a member of the Ras superfamily that functions in protein transport and membrane restructuring. RAB8 has two isoforms, RAB8A and RAB8B, that share 40% amino acid identity in the C-terminal variable region. RAB8 activity is regulated by specific guanine nucleotide exchange factors (GEFs), that mediate GTP loading, and GTPase activating proteins (GAPs) that convert them into the inactive GDP-bound form. RAB8 participates in recycling of the α-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid (AMPA) receptors to the dendritic spine surface as well as in the intracellular transport of the metabotropic glutamate receptor type 1 in neuronal cells. Rab8 is activated at the base of the cilium by its guanine nucleotide exchanger Rabin8. The antibody 11792-1-AP can detect both RAB8A and RAB8B. 55295-1-AP is specific to RAB8B and 55296-1-AP is specific to RAB8A.

Publications

What published studies show

The RAB8 Polyclonal antibody (Cat# 11792-1-AP) has 10 citations published in journals including Nature Cell Biology, Autophagy, Arterioscler Thromb Vasc Biol, EMBO Journal, EMBO Reports, J Lipid Res, Sci Rep, Eur J Immunol, Hum Mol Genet, and Cell Microbiol. Research fields span cell biology, autophagy, lipid transport, neurodegeneration, lysosome biology, hepatocyte function, neuroinflammation, genetics, and intracellular pathogen trafficking.

Automatically generated from the 10 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
canine	WB	Nat Cell Biol; A molecular network for de novo generation of the apical surface and lumen.; Authors - Bryant David M DM ; KD Validated
human	WB	Autophagy; TGFB1 is secreted through an unconventional pathway dependent on the autophagic machinery and cytoskeletal regulators.; Authors - Julian Nüchel ; KD Validated
human	WB	Arterioscler Thromb Vasc Biol; IL-1β Induces LDL Transcytosis by a Novel Pathway Involving LDLR and Rab27a; Authors - Erika Jang ; KD Validated
human	WB	EMBO J; Loss of C9ORF72 impairs autophagy and synergizes with polyQ Ataxin-2 to induce motor neuron dysfunction and cell death.; Authors - Chantal Sellier
human	WB,IF	EMBO Rep; OCRL regulates lysosome positioning and mTORC1 activity through SSX2IP-mediated microtubule anchoring.; Authors - Biao Wang ; KD Validated
mouse		Sci Rep; Murine AML12 hepatocytes allow Salmonella Typhimurium T3SS1-independent invasion and intracellular fate; Authors - S. Holbert