RAB8 Polyclonal antibody

• 

  WB analysis of fetal human brain using 11792-1-AP

  fetal human brain tissue were subjected to SDS PAGE followed by western blot with 11792-1-AP (RAB8B Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of fetal human brain using 11792-1-AP

  fetal human brain tissue were subjected to SDS PAGE followed by western blot with 11792-1-AP (RAB8B Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human brain using 11792-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 11792-1-AP (RAB8B antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse brain using 11792-1-AP

  IP result of anti-RAB8 (IP:11792-1-AP, 4ug; Detection:11792-1-AP 1:1000) with mouse brain tissue lysate 4000ug.

• 

  IHC staining of human lung cancer using 11792-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 11792-1-AP (RAB8B antibody) at dilution of 1:200 (under 10x lens) Heat mediated antigen retrieved with Sodium Citrate buffer (pH 6.0).

• 

  IHC staining of human lung cancer using 11792-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 11792-1-AP (RAB8B antibody) at dilution of 1:200 (under 40x lens) Heat mediated antigen retrieved with Sodium Citrate buffer (pH 6.0).

• 

  IF Staining of HepG2 using 11792-1-AP

  Immunofluorescent analysis of (-20℃ Ethanol) fixed HepG2 cells using 11792-1-AP (RAB8B antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

RAB8 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 11792-1-AP

Publications(9)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

RAB8B, Ras-related protein Rab-8B, Ras related protein Rab 8B

---

Tested Applications

• Positive WB detected in: fetal human brain tissue, human brain tissue
• Positive IP detected in: mouse brain tissue
• Positive IHC detected in: human lung cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 5 publications below
• WB: See 6 publications below
• IHC: See 1 publications below
• IF: See 3 publications below
• FC: See 1 publications below

Product Information

11792-1-AP targets RAB8 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, canine
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2421

  Product name: Recombinant human RAB8B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-207 aa of BC020654

  Sequence: MAKTYDYLFKLLLIGDSGVGKTCLLFRFSEDAFNTTFISTIGIDFKIRTIELDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIKNWIRNIEEHASSDVERMILGNKCDMNDKRQVSKERGEKLAIDYGIKFLETSAKSSANVEEAFFTLARDIMTKLNRKMNDSNSAGAGGPVKITENRSKKTSFFRCSLL

• Full Name: RAB8B, member RAS oncogene family
• Calculated Molecular Weight: 207 aa, 24 kDa
• Observed Molecular Weight: 24 kDa
• GenBank Accession Number: BC020654
• Gene Symbol: RAB8B
• Gene ID (NCBI): 51762
• RRID: AB_2253392
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q92930
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The Rab8 GTPase is a member of the Ras superfamily that functions in protein transport and membrane restructuring. RAB8 has two isoforms, RAB8A and RAB8B, that share 40% amino acid identity in the C-terminal variable region. RAB8 activity is regulated by specific guanine nucleotide exchange factors (GEFs), that mediate GTP loading, and GTPase activating proteins (GAPs) that convert them into the inactive GDP-bound form. RAB8 participates in recycling of the α-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid (AMPA) receptors to the dendritic spine surface as well as in the intracellular transport of the metabotropic glutamate receptor type 1 in neuronal cells. Rab8 is activated at the base of the cilium by its guanine nucleotide exchanger Rabin8. The antibody 11792-1-AP can detect both RAB8A and RAB8B. 55295-1-AP is specific to RAB8B and 55296-1-AP is specific to RAB8A.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
canine	WB	Nat Cell Biol; A molecular network for de novo generation of the apical surface and lumen.; Authors - Bryant David M DM ; KD Validated
human	WB	EMBO J; Loss of C9ORF72 impairs autophagy and synergizes with polyQ Ataxin-2 to induce motor neuron dysfunction and cell death.; Authors - Chantal Sellier
human	WB	Arterioscler Thromb Vasc Biol; IL-1β Induces LDL Transcytosis by a Novel Pathway Involving LDLR and Rab27a; Authors - Erika Jang ; KD Validated
human	WB	Autophagy; TGFB1 is secreted through an unconventional pathway dependent on the autophagic machinery and cytoskeletal regulators.; Authors - Julian Nüchel ; KD Validated
mouse	IHC,IF	Hum Mol Genet; Rab8b GTPase, a protein transport regulator, is an interacting partner of otoferlin, defective in a human autosomal recessive deafness form.; Authors - Heidrych Paulina P
human	WB,IF	EMBO Rep; OCRL regulates lysosome positioning and mTORC1 activity through SSX2IP-mediated microtubule anchoring.; Authors - Biao Wang ; KD Validated