RABGGTB Polyclonal antibody, PBS Only

• 

  WB analysis using 11801-1-AP (same clone as 11801-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 11801-1-AP (RABGGTB antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11801-1-PBS in a different storage buffer formulation.

RABGGTB Polyclonal Antibody for WB, Indirect ELISA

Cat No. 11801-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

11801-1-PBS targets RABGGTB in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2376

  Product name: Recombinant human RABGGTB protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-331 aa of BC020790

  Sequence: MGTPQKDVIIKSDAPDTLLLEKHADYIASYGSKKDDYEYCMSEYLRMSGIYWGLTVMDLMGQLHRMNREEILAFIKSCQHECGGISASIGHDPHLLYTLSAVQILTLYDSINVIDVNKVVEYVKGLQKEDGSFAGDIWGEIDTRFSFCAVATLALLGKLDAINVEKAIEFVLSCMNFDGGFGCRPGSESHAGQIYCCTGFLAITSQLHQVNSDLLGWWLCERQLPSGGLNGRPEKLPDVCYSWWVLASLKIIGRLHWIDREKLRNFILACQDEETGGFADRPGDMVDPFHTLFGIAGLSLLGEEQIKPVNPVFCMPEEVLQRVNVQPELVS

• Full Name: Rab geranylgeranyltransferase, beta subunit
• Calculated Molecular Weight: 331 aa, 37 kDa
• Observed Molecular Weight: 35 kDa
• GenBank Accession Number: BC020790
• Gene Symbol: RABGGTB
• Gene ID (NCBI): 5876
• RRID: AB_2877794
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P53611
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.