RBBP6 Polyclonal antibody, PBS Only

• 

  WB analysis using 11882-1-AP (same clone as 11882-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 11882-1-AP (RBBP6 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11882-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 11882-1-AP (same clone as 11882-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 11882-1-AP (RBBP6 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11882-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 11882-1-AP (same clone as 11882-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 11882-1-AP (RBBP6 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11882-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human rectal cancer using 11882-1-AP (same clone as 11882-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human rectal cancer tissue slide using 11882-1-AP (RBBP6 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11882-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 11882-1-AP (same clone as 11882-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 11882-1-AP (RBBP6 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11882-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

RBBP6 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 11882-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

E3 ubiquitin-protein ligase RBBP6, EC:2.3.2.27, MY038, P2P R, P2PR

---

Product Information

11882-1-PBS targets RBBP6 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2484

  Product name: Recombinant human RBBP6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-118 aa of BC029352

  Sequence: MSCVHYKFSSKLNYDTVTFDGLHISLCDLKKQIMGREKLKAADCDLQITNAQTKEEYTDDNALIPKNSSVIVRRIPIGGVKSTSKTYVISRTEPAMATTKAVCKNTISHFFYTLLLPL

• Full Name: retinoblastoma binding protein 6
• Calculated Molecular Weight: 1792 aa, 200 kDa
• Observed Molecular Weight: 250 kDa
• GenBank Accession Number: BC029352
• Gene Symbol: RBBP6
• Gene ID (NCBI): 5930
• RRID: AB_2177794
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q7Z6E9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

RBBP6 (retinoblastoma binding protein 6) is a multifunctional protein that interacts with both p53 and pRb and has been implicated in mRNA processing. It has also been identified as a putative E3 ubiquitin ligase due to the presence of a RING finger domain [PMID:18851979]. RBBP6 contains an N-terminal ubiquitin-like domain and a cysteine-rich RING finger-like domain, through which it promotes the ubiquitination of p53 by Hdm2 in an E4-like manner [PMID:17470788]. It is implicated in a diverse set of cellular functions, including mRNA metabolism, regulation of the cell cycle, tumorigenesis, and development [PMID:12938151,17470788].