RBP2 Polyclonal antibody

• 

  WB analysis using 31527-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 31527-1-AP (RBP2 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human small intestine using 31527-1-AP

  Immunohistochemical analysis of paraffin-embedded human small intestine tissue slide using 31527-1-AP (RBP2 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human small intestine using 31527-1-AP

  Immunohistochemical analysis of paraffin-embedded human small intestine tissue slide using 31527-1-AP (RBP2 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

RBP2 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 31527-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

CRBP2, Retinol binding protein 2

---

Tested Applications

• Positive WB detected in: mouse small intestine tissue, rat small intestine tissue
• Positive IHC detected in: human small intestine tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

31527-1-AP targets RBP2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35801

  Product name: Recombinant human RBP2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 31-134 aa of NM_004164.2

  Sequence: RKIAVRLTQTKVIDQDGDNFKTKTTSTFRNYDVDFTVGVEFDEYTKSLDNRHVKALVTWEGDVLVCVQKGEKENRGWKQWIEGDKLYLELTCGDQVCRQVFKKK

• Full Name: retinol binding protein 2, cellular
• Calculated Molecular Weight: 16 kDa
• Observed Molecular Weight: 16 kDa
• GenBank Accession Number: NM_004164.2
• Gene Symbol: RBP2
• Gene ID (NCBI): 5948
• RRID: AB_3670022
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: P50120
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Retinol-binding protein 2 (RBP2) also known as CRBP2, CRBP-II, is an abundant 134-residue protein confined largely to the small intestinal enterocyte. It is thought to participate in the uptake and/or intracellular metabolism of vitamin A(PMID: 3029082).