RBP4 Polyclonal antibody, PBS Only

• 

  WB analysis using 29550-1-AP (same clone as 29550-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 29550-1-AP (RBP4 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 29550-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 29550-1-AP (same clone as 29550-1-PBS)

  WB result of RBP4 antibody (29550-1-AP; 1:600; incubated at room temperature for 1.5 hours) with sh-Control and sh-RBP4 transfected HepG2 cells. This data was developed using the same antibody clone with 29550-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

RBP4 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 29550-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

Plasma retinol binding protein, Plasma retinol-binding protein, Plasma retinol-binding protein(1-176), Plasma retinol-binding protein(1-179), Plasma retinol-binding protein(1-181)

---

Product Information

29550-1-PBS targets RBP4 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Eg31642

  Product name: Recombinant Human RBP4 protein (Myc Tag, His Tag)

  Source: mammalian cells-derived, pHZ-KIsec

  Tag: Myc & 6*His

  Domain: 19-201 aa of BC020633

  Sequence: ERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSERNLL

• Full Name: retinol binding protein 4, plasma
• Calculated Molecular Weight: 201 aa, 23 kDa
• Observed Molecular Weight: 23 kDa
• GenBank Accession Number: BC020633
• Gene Symbol: RBP4
• Gene ID (NCBI): 5950
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P02753
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

RBP4 (Retinol-binding protein 4), also known as PRO2222. It is expected to be located in the cytoplasm, which is expressed in renal tubules, pancreatic islets and hepatocytes with positivity in plasma. This protein belongs to the lipocalin family and is the specific carrier for retinol (vitamin A alcohol) in the blood. It delivers retinol from the liver stores to the peripheral tissues. In plasma, the RBP-retinol complex interacts with transthyretin which prevents its loss by filtration through the kidney glomeruli. A deficiency of vitamin A blocks secretion of the binding protein post- translationally and results in defective delivery and supply to the epidermal cells. The molecular weight of RBP4 is 23 kDa.