Tested Applications
| Positive WB detected in | mouse brain tissue, rat brain tissue |
| Positive IP detected in | mouse brain tissue |
| Positive IHC detected in | human gliomas tissue, human skin tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
12900-1-AP targets RCAN2 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, zebrafish |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag3597 Product name: Recombinant human RCAN2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 35-201 aa of BC038509 Sequence: LFRTYDDCVTFQLFKSFRRVRINFSNPKSAARARIELHETQFRGKKLKLYFAQVQTPETDGDKLHLAPPQPAKQFLISPPSSPPVGWQPINDATPVLNYDLLYAVAKLGPGEKYELHAGTESTPSVVVHVCDSDIEEEEDPKTSPKPKIIQTRRPGLPPSVSNWAAC Predict reactive species |
| Full Name | regulator of calcineurin 2 |
| Calculated Molecular Weight | 225 aa, 25 kDa |
| Observed Molecular Weight | 24 kDa |
| GenBank Accession Number | BC038509 |
| Gene Symbol | RCAN2 |
| Gene ID (NCBI) | 10231 |
| RRID | AB_10638913 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q14206 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
RCAN2 is a member of the regulator of calcineurin (RCAN) protein family. These proteins play a role in many physiological processes by binding to the catalytic domain of calcineurin A, inhibiting calcineurin-mediated nuclear translocation of the transcription factor NFATC1. Expression of this gene in skin fibroblasts is upregulated by thyroid hormone, and the encoded protein may also play a role in endothelial cell function and angiogenesis.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for RCAN2 antibody 12900-1-AP | Download protocol |
| IP protocol for RCAN2 antibody 12900-1-AP | Download protocol |
| WB protocol for RCAN2 antibody 12900-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
RCAN2 Polyclonal antibody (Cat# 12900-1-AP) has 6 total citations. These appear in Int J Biol Sci, Cancer Cell Int, PLoS Biol, Cell Biol Toxicol, Front Biosci (Landmark Ed), and Toxicol Appl Pharmacol. Research fields span neural crest cell dysfunction in folate deficiency, hepatocellular carcinoma prognostic modeling and apoptosis, colorectal cancer stem cell properties, zebrafish pectoral fin development, and lipophagy in non-alcoholic fatty liver disease.
| Species | Application | Title |
|---|---|---|
Int J Biol Sci Up-regulation of RNA Binding Proteins Contributes to Folate Deficiency-Induced Neural Crest Cells Dysfunction. | ||
Cancer Cell Int Construction of a single nucleotide variant score-related gene-based prognostic model in hepatocellular carcinoma: analysis of multi-independent databases and validation in vitro.
| ||
PLoS Biol The scale of zebrafish pectoral fin buds is determined by intercellular K+ levels and consequent Ca2+-mediated signaling via retinoic acid regulation of Rcan2 and Kcnk5b | ||
Cell Biol Toxicol USP7-mediated JUND suppresses RCAN2 transcription and elevates NFATC1 to enhance stem cell property in colorectal cancer | ||
Front Biosci (Landmark Ed) TMB Signature-Related RCAN2 Promotes Apoptosis by Upregulating EHF/DR5 Pathway in Hepatocellular Carcinoma
| ||
Toxicol Appl Pharmacol Knockdown of regulator of Calcineurin 2 promotes transcription factor EB-mediated lipophagy to prevent non-alcoholic fatty liver disease |
