RCAN2 Polyclonal antibody

• 

  WB analysis using 12900-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 12900-1-AP (RCAN2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse brain using 12900-1-AP

  IP result of anti-RCAN2 (IP:12900-1-AP, 4ug; Detection:12900-1-AP 1:300) with mouse brain tissue lysate 4400 ug.

• 

  IHC staining of human gliomas using 12900-1-AP

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 12900-1-AP (RCAN2 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human gliomas using 12900-1-AP

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 12900-1-AP (RCAN2 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human skin using 12900-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin tissue slide using 12900-1-AP (RCAN2 Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human skin using 12900-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin tissue slide using 12900-1-AP (RCAN2 Antibody) at dilution of 1:50 (under 40x lens).

• Featured Product
• KD/KO Validated

RCAN2 Polyclonal Antibody for WB, IP, IHC, ELISA

Cat No. 12900-1-AP

Publications(6)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IP, ELISA

Synonyms

Calcipressin 2, CSP2, DSCR1L1, hRCN2, MCIP2, RCAN2, regulator of calcineurin 2, ZAKI 4, ZAKI4

---

Tested Applications

• Positive WB detected in: mouse brain tissue, rat brain tissue
• Positive IP detected in: mouse brain tissue
• Positive IHC detected in: human gliomas tissue, human skin tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 5 publications below
• IHC: See 3 publications below

Product Information

12900-1-AP targets RCAN2 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, zebrafish
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3597

  Product name: Recombinant human RCAN2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 35-201 aa of BC038509

  Sequence: LFRTYDDCVTFQLFKSFRRVRINFSNPKSAARARIELHETQFRGKKLKLYFAQVQTPETDGDKLHLAPPQPAKQFLISPPSSPPVGWQPINDATPVLNYDLLYAVAKLGPGEKYELHAGTESTPSVVVHVCDSDIEEEEDPKTSPKPKIIQTRRPGLPPSVSNWAAC

• Full Name: regulator of calcineurin 2
• Calculated Molecular Weight: 225 aa, 25 kDa
• Observed Molecular Weight: 24 kDa
• GenBank Accession Number: BC038509
• Gene Symbol: RCAN2
• Gene ID (NCBI): 10231
• RRID: AB_10638913
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q14206
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RCAN2 is a member of the regulator of calcineurin (RCAN) protein family. These proteins play a role in many physiological processes by binding to the catalytic domain of calcineurin A, inhibiting calcineurin-mediated nuclear translocation of the transcription factor NFATC1. Expression of this gene in skin fibroblasts is upregulated by thyroid hormone, and the encoded protein may also play a role in endothelial cell function and angiogenesis.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IHC	Cell Biol Toxicol; USP7-mediated JUND suppresses RCAN2 transcription and elevates NFATC1 to enhance stem cell property in colorectal cancer; Authors - Yunli Chang
human	IHC,WB	Cancer Cell Int; Construction of a single nucleotide variant score-related gene-based prognostic model in hepatocellular carcinoma: analysis of multi-independent databases and validation in vitro.; Authors - Yu-Jie Xu ; KD Validated
human	WB	Int J Biol Sci; Up-regulation of RNA Binding Proteins Contributes to Folate Deficiency-Induced Neural Crest Cells Dysfunction.; Authors - Wenbo Liu
zebrafish		PLoS Biol; The scale of zebrafish pectoral fin buds is determined by intercellular K+ levels and consequent Ca2+-mediated signaling via retinoic acid regulation of Rcan2 and Kcnk5b; Authors - Xiaowen Jiang
human	WB,IHC	Front Biosci (Landmark Ed); TMB Signature-Related RCAN2 Promotes Apoptosis by Upregulating EHF/DR5 Pathway in Hepatocellular Carcinoma; Authors - Yu-Jie Xu ; KO Validated
human,mouse	WB	Toxicol Appl Pharmacol; Knockdown of regulator of Calcineurin 2 promotes transcription factor EB-mediated lipophagy to prevent non-alcoholic fatty liver disease; Authors - Lei Shan