RCBTB2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• RCBTB2 Polyclonal antibody (13225-1-AP)

RCBTB2 Polyclonal Antibody for WB, ELISA

Cat No. 13225-1-AP Copied!

Publications (4)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF, ELISA

Synonyms

CHC1 L, CHC1L, Chromosome condensation 1 like, RCBTB2, RCC1 like G exchanging factor, RLG

• 

  WB analysis using 13225-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 13225-1-AP (RCBTB2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse thymus using 13225-1-AP

  mouse thymus tissue were subjected to SDS PAGE followed by western blot with 13225-1-AP (RCBTB2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for RCBTB2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse thymus tissue, rat thymus tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

13225-1-AP targets RCBTB2 in WB, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3975

  Product name: Recombinant human RCBTB2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 209-551 aa of BC029052

  Sequence: TIACGQMCCMAVVDTGEVYVWGYNGNGQLGLGNSGNQPTPCRVAALQGIRVQRVACGYAHTLVLTDEGQVYAWGANSYGQLGTGNKSNQSYPTPVTVEKDRIIEIAACHSTHTSAAKTQGGHVYMWGQCRGQSVILPHLTHFSCTDDVFACFATPAVTWRLLSVEPDDHLTVAESLKREFDNPDTADLKFLVDGKYIYAHKVLLKIRCEHFRSSLEDNEDDIVEMSEFSYPVYRAFLEYLYTDSISLSPEEAVGLLDLATFYRENRLKKLCQQTIKQGICEENAIALLSAAVKYDAQDLEEFCFRFCINHLTVVTQTSGFAEMDHDLLKNFISKASRVGAFKN

• Full Name: regulator of chromosome condensation (RCC1) and BTB (POZ) domain containing protein 2
• Calculated Molecular Weight: 551 aa, 60 kDa
• Observed Molecular Weight: 58-60 kDa
• GenBank Accession Number: BC029052
• Gene Symbol: RCBTB2
• Gene ID (NCBI): 1102
• RRID: AB_2179570
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O95199
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The RCBTB2 Polyclonal antibody (Cat# 13225-1-AP) has 4 total citations. These appear in Nature Communications, Biomedical and Environmental Sciences, Toxicology and Applied Pharmacology, and American Journal of Cancer Research. The associated research fields include spermatogenesis and reproductive biology, ovarian cancer proliferation and invasion, hepatoma cell toxicity and proteomic profiling, and prostate cancer progression involving aggrephagy regulation.

Automatically generated from the 4 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB,IF	Nat Commun; CEP128 is involved in spermatogenesis in humans and mice.; Authors - Xueguang Zhang
human	WB	Biomed Environ Sci; Ezrin Promotes the Proliferation, Migration, and Invasion of Ovarian Cancer Cells.; Authors - Mo Juan Li
human	WB	Toxicol Appl Pharmacol; Proteomic profiling revealed the functional networks associated with mitotic catastrophe of HepG2 hepatoma cells induced by 6-bromine-5-hydroxy-4-methoxybenzaldehyde.; Authors - Zhang Bo B
human	WB,IF	Am J Cancer Res; The ubiquitin ligase RCBTB2 regulates aggrephagy and inhibits prostate cancer progression by targeting GPAA1 for degradation.; Authors - Ren Mo