REG Polyclonal antibody, PBS Only

• 

  WB analysis using 15850-1-AP (same clone as 15850-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 15850-1-AP (REG antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15850-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach cancer using 15850-1-AP (same clone as 15850-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer slide using 15850-1-AP (REG antibody) at dilution of 1:800 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15850-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach cancer using 15850-1-AP (same clone as 15850-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 15850-1-AP (REG antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15850-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach cancer using 15850-1-AP (same clone as 15850-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 15850-1-AP (REG antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15850-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach cancer using 15850-1-AP (same clone as 15850-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 15850-1-AP (REG antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15850-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 15850-1-AP (same clone as 15850-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 15850-1-AP (REG antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15850-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 15850-1-AP (same clone as 15850-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 15850-1-AP (REG antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15850-1-PBS in a different storage buffer formulation.

REG Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 15850-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

REG1 alpha, REG1A, Pancreatic thread protein, Pancreatic stone protein, P19

---

Product Information

15850-1-PBS targets REG in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8640

  Product name: Recombinant human REG protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-166 aa of BC005350

  Sequence: MAQTSSYFMLISCLMFLSQSQGQEAQTELPQARISCPEGTNAYRSYCYYFNEDRETWVDADLYCQNMNSGNLVSVLTQAEGAFVASLIKESGTDDFNVWIGLHDPKKNRRWHWSSGSLVSYKSWGIGAPSSVNPGYCVSLTSSTGFQKWKDVPCEDKFSFVCKFKN

• Full Name: regenerating islet-derived 1 alpha
• Calculated Molecular Weight: 166 aa, 19 kDa
• Observed Molecular Weight: 19 kDa
• GenBank Accession Number: BC005350
• Gene Symbol: REG
• Gene ID (NCBI): 5967
• RRID: AB_2878192
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P05451
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.