REG3A Polyclonal antibody, PBS Only

• 

  WB analysis using 13610-1-AP (same clone as 13610-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 13610-1-AP (REG3A antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13610-1-PBS in a different storage buffer formulation.

REG3A Polyclonal Antibody for WB, Indirect ELISA

Cat No. 13610-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

13610-1-PBS targets REG3A in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4508

  Product name: Recombinant human REG3A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-175 aa of BC036776

  Sequence: MLPPMALPSVSWMLLSCLMLLSQVQGEEPQRELPSARIRCPKGSKAYGSHCYALFLSPKSWTDADLACQKRPSGNLVSVLSGAEGSFVSSLVKSIGNSYSYVWIGLHDPTQGTEPNGEGWEWSSSDVMNYFAWERNPSTISSPGHCASLSRSTAFLRWKDYNCNVRLPYVCKFTD

• Full Name: regenerating islet-derived 3 alpha
• Calculated Molecular Weight: 175 aa, 19 kDa
• Observed Molecular Weight: 16 kDa
• GenBank Accession Number: BC036776
• Gene Symbol: REG3A
• Gene ID (NCBI): 5068
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q06141
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Regenerating family member 3 alpha (Reg3A) encodes a pancreatic secretory protein that may be involved in cell proliferation or differentiation. During pancreatic inflammation, the secretion of Reg3A by inflamed acinar cells is sensitively and markedly upregulated. The mature protein also functions as an antimicrobial protein with antibacterial activity.