Product Information
60570-2-PBS targets RENIN-RECEPTOR,ATP6AP2 as part of a matched antibody pair:
MP50807-1: 60570-1-PBS capture and 60570-2-PBS detection (validated in Cytometric bead array)
Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
Tested Reactivity | human |
Host / Isotype | Mouse / IgG1 |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag17725 Product name: Recombinant human RENIN-RECEPTOR,ATP6AP2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-99 aa of BC010395 Sequence: MYSLYGGNAVVELVTVKSFDTSLIRKTRTILEAKQANPASPYNLAYKYNFEYSVVFNMVLWIMIALALAVIITSYNIWNMDPGYDSIIYRMTNQKIRMD Predict reactive species |
Full Name | ATPase, H+ transporting, lysosomal accessory protein 2 |
Calculated Molecular Weight | 39 kDa |
GenBank Accession Number | BC010395 |
Gene Symbol | Renin receptor |
Gene ID (NCBI) | 10159 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein G Magarose purification |
UNIPROT ID | O75787 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |