RFC1 Polyclonal antibody

• 

  WB analysis of Jurkat using 19159-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 19159-1-AP (RFC1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 19159-1-AP

  WB result of RFC1 antibody (19159-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-RFC1 transfected HeLa cells.

• Featured Product
• KD/KO Validated

RFC1 Polyclonal Antibody for WB, ELISA

Cat No. 19159-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

DNA binding protein PO GA, Activator 1 subunit 1, Activator 1 large subunit, Activator 1 140 kDa subunit, A1 140 kDa subunit

---

Tested Applications

• Positive WB detected in: Jurkat cells, HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

19159-1-AP targets RFC1 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13585

  Product name: Recombinant human RFC1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 888-1147 aa of BC051751

  Sequence: YIHVKPVAAGGDMKKHLMLLSRAADSICDGDLVDSQIRSKQNWSLLPAQAIYASVLPGELMRGYMTQFPTFPSWLGKHSSTGKHDRIVQDLALHMSLRTYSSKRTVNMDYLSLLRDALVQPLTSQGVDGVQDVVALMDTYYLMKEDFENIMEISSWGGKPSPFSKLDPKVKAAFTRAYNKEAHLTPYSLQAIKASRHSTSPSLDSEYNEELNEDDSQSDEKDQDAIETDAMIKKKTKSSKPSKPEKDKEPRKGKGKSSKK

• Full Name: replication factor C (activator 1) 1, 145kDa
• Calculated Molecular Weight: 128 kDa
• Observed Molecular Weight: 128-150 kDa
• GenBank Accession Number: BC051751
• Gene Symbol: RFC1
• Gene ID (NCBI): 5981
• RRID: AB_2878574
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P35251
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Replication factor C subunit 1 (RFC1) is a pentameric DNA polymerase accessory protein involved in DNA replication and repair (PMID: 10051561). It was reported as a cause of cerebellar ataxia with neuropathy and vestibular areflexia syndrome (CANVAS) (PMID: 30926972).