RFC1 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis of HeLa using 85148-1-RR (same clone as 85148-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 85148-1-RR (RFC1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85148-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 85148-1-RR

  Biolayer interferometry (BLl) kinetic assays of 85148-1-RR against Human RFC1 were performed. The affinity constant is below 1 pM.

RFC1 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 85148-1-PBS

Clone No.242818A5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

242818A5, A1, A1 140 kDa subunit, Activator 1 140 kDa subunit, Activator 1 large subunit

---

Product Information

85148-1-PBS targets RFC1 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag13585

  Product name: Recombinant human RFC1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 888-1147 aa of BC051751

  Sequence: YIHVKPVAAGGDMKKHLMLLSRAADSICDGDLVDSQIRSKQNWSLLPAQAIYASVLPGELMRGYMTQFPTFPSWLGKHSSTGKHDRIVQDLALHMSLRTYSSKRTVNMDYLSLLRDALVQPLTSQGVDGVQDVVALMDTYYLMKEDFENIMEISSWGGKPSPFSKLDPKVKAAFTRAYNKEAHLTPYSLQAIKASRHSTSPSLDSEYNEELNEDDSQSDEKDQDAIETDAMIKKKTKSSKPSKPEKDKEPRKGKGKSSKK

• Full Name: replication factor C (activator 1) 1, 145kDa
• Calculated Molecular Weight: 128 kDa
• Observed Molecular Weight: 128-150 kDa
• GenBank Accession Number: BC051751
• Gene Symbol: RFC1
• Gene ID (NCBI): 5981
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P35251
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Replication factor C subunit 1 (RFC1) is a pentameric DNA polymerase accessory protein involved in DNA replication and repair (PMID: 10051561). It was reported as a cause of cerebellar ataxia with neuropathy and vestibular areflexia syndrome (CANVAS) (PMID: 30926972).