RFC5 Polyclonal antibody, PBS Only

• 

  WB analysis using 28671-1-AP (same clone as 28671-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 28671-1-AP (RFC5 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 28671-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 28671-1-AP (same clone as 28671-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using RFC5 antibody (28671-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 28671-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 28671-1-AP (same clone as 28671-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using RFC5 antibody (28671-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 28671-1-PBS in a different storage buffer formulation.

RFC5 Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 28671-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

A1 36 kDa subunit, Activator 1 36 kDa subunit, Activator 1 subunit 5, Replication factor C subunit 5, RF C 36 kDa subunit

---

Product Information

28671-1-PBS targets RFC5 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29236

  Product name: Recombinant human RFC5 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 219-341 aa of BC001866

  Sequence: ILQSTNMAFGKVTEETVYTCTGHPLKSDIANILDWMLNQDFTTAYRNITELKTLKGLALHDILTEIHLFVHRVDFPSSVRIHLLTKMADIEYRLSVGTNEKIQLSSLIAAFQVTRDLIVAEA

• Full Name: replication factor C (activator 1) 5, 36.5kDa
• Calculated Molecular Weight: 38 kDa
• Observed Molecular Weight: 38 kDa
• GenBank Accession Number: BC001866
• Gene Symbol: RFC5
• Gene ID (NCBI): 5985
• RRID: AB_2918189
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P40937
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Replication factor C subunit 5 (RFC5), also known as activator 1, can recruit proliferating cell nuclear antigen(PCNA) onto the DNA polymerase S-phase checkpoint complex. In eukaryotes, RFC5 is involved in repairing mismatches, DNA double helix damage, nucleotide excision, and regulating the cell cycle(PMID: 30210909). RFC5 is significantly upregulated in cancer tissues or cells, and its expression is elevated with the cancer progression(PMID: 30214556).