RGS14 Polyclonal antibody

• 

  WB analysis using 16258-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 16258-1-AP (RGS14 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse brain using 16258-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 16258-1-AP (RGS14 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse testis using 16258-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 16258-1-AP (RGS14 Antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse spleen using 16258-1-AP

  mouse spleen tissue were subjected to SDS PAGE followed by western blot with 16258-1-AP (RGS14 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse brain using 16258-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 16258-1-AP (RGS14 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse brain using 16258-1-AP

  IP result of anti-RGS14 (IP:16258-1-AP, 3ug; Detection:16258-1-AP 1:1000) with mouse brain tissue lysate 5000ug.

• 

  IHC staining of mouse brain using 16258-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 16258-1-AP (RGS14 antibody) at dilution of 1:5000 (under 4x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 16258-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 16258-1-AP (RGS14 antibody) at dilution of 1:5000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

RGS14 Polyclonal Antibody for WB, IP, IHC, ELISA

Cat No. 16258-1-AP

Publications(11)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (2)

Applications

WB, IHC, IF, IP, CoIP, ELISA

Synonyms

RGS14

---

Tested Applications

• Positive WB detected in: HeLa cells, mouse testis tissue, mouse brain tissue, mouse spleen tissue, HepG2 cells, HuH-7 cells, mouse liver tissue
• Positive IP detected in: mouse brain tissue
• Positive IHC detected in: mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:2500-1:10000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 6 publications below
• IHC: See 3 publications below
• IF: See 5 publications below
• IP: See 1 publications below
• CoIP: See 1 publications below

Product Information

16258-1-AP targets RGS14 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, rat, monkey
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9292

  Product name: Recombinant human RGS14 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 217-566 aa of BC014094

  Sequence: KSLPLGVEELGQLPPVEGPGGRPLRKSFRRELGGTANAALRRESQGSLNSSASLDLGFLAFVSSKSESHRKSLGSTEGESESRPGKYCCVYLPDGTASLALARPGLTIRDMLAGICEKRGLSLPDIKVYLVGNEQALVLDQDCTVLADQEVRLENRITFELELTALERVVRISAKPTKRLQEALQPILEKHGLSPLEVVLHRPGEKQPLDLGKLVSSVAAQRLVLDTLPGVKISKARDKSPCRSQGCPPRTQDKATHPPPASPSSLVKVPSSATGKRQTCDIEGLVELLNRVQSSGAHDQRGLLRKEDLVLPEFLQLPAQGPSSEETPPQTKSAAQPIGGSLNSTTDSAL

• Full Name: regulator of G-protein signaling 14
• Calculated Molecular Weight: 566 aa, 61 kDa
• Observed Molecular Weight: 60-65 kDa
• GenBank Accession Number: BC014094
• Gene Symbol: RGS14
• Gene ID (NCBI): 10636
• RRID: AB_2179918
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O43566
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RGS14, a member of the R12 subfamily of RGS proteins, is highly expressed in the brain and is a natural suppressor of CA2 hippocampal synaptic plasticity and learning and memory. RGS14 was first identified as a complex scaffolding protein with an unconventional domain structure that allows it to interact with various protein binding partners. RGS14 contains one RGS domain, two Raf-like Ras-binding domains (RBDs), and one GoLoco domain. The protein attenuates the signaling activity of G-proteins by binding, through its GoLoco domain, to specific types of activated, GTP-bound G alpha subunits. Acting as a GTPase activating protein (GAP), the protein increases the rate of conversion of the GTP to GDP.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human,mouse	WB,CoIP	Mol Metab; Hepatic Regulator of G protein Signaling 14 Ameliorates NAFLD through Activating cAMP-AMPK Signaling by Targeting Giα1/3; Authors - Junyong Wang ; KO Validated
human,monkey	WB,IHC	Brain Struct Funct; Regulator of G protein signaling 14 (RGS14) is expressed pre- and postsynaptically in neurons of hippocampus, basal ganglia, and amygdala of monkey and human brain.; Authors - Katherine E Squires
rat	IHC	Exp Neurol; Modelling cognitive deficits in Parkinson's disease: Is CA2 a gateway for hippocampal synucleinopathy?; Authors - Elif Cinar
human	WB, IF	J Biol Chem; Human genetic variants disrupt RGS14 nuclear shuttling and regulation of LTP in hippocampal neurons.; Authors - Katherine E Squires
human	WB,IF	J Biol Chem; RGS14 regulates hormone-sensitive NPT2A-mediated renal phosphate uptake via binding to the NHERF1 scaffolding protein.; Authors - Peter A Friedman
mouse	IP	J Biol Chem; 14-3-3γ binds RGS14 at distinct sites to inhibit the RGS14:Gαi-AlF4- signaling complex and RGS14 nuclear localization.; Authors - Kyle J Gerber