RGS14 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• RGS14 Polyclonal antibody (16258-1-AP)

• Featured Product
• KD/KO Validated

RGS14 Polyclonal Antibody for WB, IP, IHC, ELISA

Cat No. 16258-1-AP Copied!

Publications (16)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (2)

Applications

WB, IHC, IF, IP, CoIP, ELISA

Synonyms

RGS14

• 

  WB analysis using 16258-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 16258-1-AP (RGS14 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse brain using 16258-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 16258-1-AP (RGS14 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse testis using 16258-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 16258-1-AP (RGS14 Antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse brain using 16258-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 16258-1-AP (RGS14 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse spleen using 16258-1-AP

  mouse spleen tissue were subjected to SDS PAGE followed by western blot with 16258-1-AP (RGS14 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of mouse brain using 16258-1-AP

  IP result of anti-RGS14 (IP:16258-1-AP, 3ug; Detection:16258-1-AP 1:1000) with mouse brain tissue lysate 5000ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 16258-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 16258-1-AP (RGS14 antibody) at dilution of 1:5000 (under 4x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 16258-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 16258-1-AP (RGS14 antibody) at dilution of 1:5000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for RGS14 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HeLa cells, mouse testis tissue, mouse brain tissue, mouse spleen tissue, HepG2 cells, HuH-7 cells, mouse liver tissue
• Positive IP detected in: mouse brain tissue
• Positive IHC detected in: mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:2500-1:10000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

16258-1-AP targets RGS14 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, rat, monkey
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9292

  Product name: Recombinant human RGS14 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 217-566 aa of BC014094

  Sequence: KSLPLGVEELGQLPPVEGPGGRPLRKSFRRELGGTANAALRRESQGSLNSSASLDLGFLAFVSSKSESHRKSLGSTEGESESRPGKYCCVYLPDGTASLALARPGLTIRDMLAGICEKRGLSLPDIKVYLVGNEQALVLDQDCTVLADQEVRLENRITFELELTALERVVRISAKPTKRLQEALQPILEKHGLSPLEVVLHRPGEKQPLDLGKLVSSVAAQRLVLDTLPGVKISKARDKSPCRSQGCPPRTQDKATHPPPASPSSLVKVPSSATGKRQTCDIEGLVELLNRVQSSGAHDQRGLLRKEDLVLPEFLQLPAQGPSSEETPPQTKSAAQPIGGSLNSTTDSAL

• Full Name: regulator of G-protein signaling 14
• Calculated Molecular Weight: 566 aa, 61 kDa
• Observed Molecular Weight: 60-65 kDa
• GenBank Accession Number: BC014094
• Gene Symbol: RGS14
• Gene ID (NCBI): 10636
• RRID: AB_2179918
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O43566
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RGS14, a member of the R12 subfamily of RGS proteins, is highly expressed in the brain and is a natural suppressor of CA2 hippocampal synaptic plasticity and learning and memory. RGS14 was first identified as a complex scaffolding protein with an unconventional domain structure that allows it to interact with various protein binding partners. RGS14 contains one RGS domain, two Raf-like Ras-binding domains (RBDs), and one GoLoco domain. The protein attenuates the signaling activity of G-proteins by binding, through its GoLoco domain, to specific types of activated, GTP-bound G alpha subunits. Acting as a GTPase activating protein (GAP), the protein increases the rate of conversion of the GTP to GDP.

Publications

What published studies show

The RGS14 antibody (Cat# 16258-1-AP) has 16 total citations spanning journals including Nature, Nature Communications, Journal of Biological Chemistry, Molecular Metabolism, Cancer Genetics, Brain Structure and Function, Experimental Neurology, Biochemical Journal, Hippocampus, PLoS ONE, Journal of Comparative Neurology, Histology and Histopathology, and Research Square. Research fields cover neuroscience (hippocampal parcellation, synaptic plasticity, Parkinson's disease), metabolism (NAFLD, AMPK signaling), cancer (hepatocellular carcinoma), renal phosphate transport, and cerebral ischemia protection.

Automatically generated from the 16 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Nature; Procognitive restoration of PV neuron plasticity in neurodevelopmental disorders.; Authors - Yu-Tzu Shih
mouse	IHC	Nat Commun; Bidirectional regulation of social memory by two distinct types of GABAergic neurons in the lateral septum.; Authors - Li Zhang
human	WB	Cancer Genet; Regulator of G-protein signaling 14 (RGS14) promotes cancer growth in hepatocellular carcinoma; Authors - Yi Ran
human,mouse	WB,CoIP	Mol Metab; Hepatic Regulator of G protein Signaling 14 Ameliorates NAFLD through Activating cAMP-AMPK Signaling by Targeting Giα1/3; Authors - Junyong Wang ; KO Validated
rat	IHC	Exp Neurol; Modelling cognitive deficits in Parkinson's disease: Is CA2 a gateway for hippocampal synucleinopathy?; Authors - Elif Cinar
human	WB, IF	J Biol Chem; Human genetic variants disrupt RGS14 nuclear shuttling and regulation of LTP in hippocampal neurons.; Authors - Katherine E Squires