RIM1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• RIM1 Polyclonal antibody (24576-1-AP)

• Featured Product
• KD/KO Validated

RIM1 Polyclonal Antibody for WB, IP, IHC, ELISA

Cat No. 24576-1-AP Copied!

Publications (8)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, ELISA

Synonyms

CORD7, KIAA0340, Rab 3 interacting molecule 1, Rab 3 interacting protein 2, RAB3IP2, RIM, RIM 1, RIM1, RIMS1

• 

  WB analysis using 24576-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 24576-1-AP (RIM1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of mouse brain using 24576-1-AP

  IP result of anti-RIM1 (IP:24576-1-AP, 4ug; Detection:24576-1-AP 1:1000) with mouse brain tissue lysate 4000ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 24576-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 24576-1-AP (RIM1 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 24576-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 24576-1-AP (RIM1 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for RIM1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse brain tissue, rat brain tissue
• Positive IP detected in: mouse brain tissue
• Positive IHC detected in: mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

24576-1-AP targets RIM1 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20161

  Product name: Recombinant human RIMS1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 923-1039 aa of BC152435

  Sequence: KSTTLTVPEQQRTTHHRSRSVSPHRGNDQGKPRSRLPNVPLQRSLDEIHPTRRSRSPTRHHDASRSPVDHRTRDVDSQYLSEQDSELLMLPRAKRGRSAECLHTTR

• Full Name: regulating synaptic membrane exocytosis 1
• Calculated Molecular Weight: 1692 aa, 189 kDa
• Observed Molecular Weight: 189 kDa
• GenBank Accession Number: BC152435
• Gene Symbol: RIMS1
• Gene ID (NCBI): 22999
• RRID: AB_2879618
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q86UR5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RIMS1 is a RAS gene superfamily member that regulates synaptic vesicle exocytosis. RIMS1 also plays a role in the regulation of voltage-gated calcium channels during neurotransmitter and insulin release. Mutations in RIMS1 have suggested a role cognition and have been identified as the cause of cone-rod dystrophy type 7.

Publications

What published studies show

The RIM1 Polyclonal antibody (catalog 24576-1-AP) has 8 total citations. Citations appear in journals including Neuron, Science Advances, Neurochemistry International, Experimental Neurology, Neurochemistry Research, iScience, and bioRxiv. The associated research fields focus on neuroscience, particularly synaptic transmission, neurotransmitter release, and presynaptic protein regulation. Studies also explore neurodevelopmental disorders, epilepsy, traumatic brain injury, schizophrenia, and Parkinson's disease, with applications primarily in Western blot across human, mouse, and rat models.

Automatically generated from the 8 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Neuron; Neurexin-1γ drives synaptic transmission through structural integration of neurotransmitter release machinery and postsynaptic receptor nanodomains.; Authors - Nirmala Padmanabhan
mouse	WB	Neuron; Differential Regulation of Evoked and Spontaneous Release by Presynaptic NMDA Receptors; Authors - ; KO Validated
human	WB	Sci Adv; Phosphorylation of Doc2 by EphB2 modulates Munc13-mediated SNARE complex assembly and neurotransmitter release; Authors - Hong Zhang
rat	WB	Neurochem Int; Effects of exercise-induced fatigue on the morphology of asymmetric synapse and synaptic protein levels in rat striatum.; Authors - Zhifeng Wang
mouse	WB	Exp Neurol; Gene knockout of RNA binding motif 5 in the brain alters RIMS2 protein homeostasis in the cerebellum and Hippocampus and exacerbates behavioral deficits after a TBI in mice; Authors - Kara Snyder
human	WB	iScience; Using brain cell-type-specific protein interactomes to interpret neurodevelopmental genetic signals in schizophrenia; Authors - Yu-Han H Hsu