RIM1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• RIM1 Polyclonal antibody (24576-1-AP)

• Featured Product
• KD/KO Validated

RIM1 Polyclonal Antibody for WB, IP, IHC, ELISA

Cat No. 24576-1-AP

Publications(8)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, ELISA

Synonyms

CORD7, KIAA0340, Rab 3 interacting molecule 1, Rab 3 interacting protein 2, RAB3IP2, RIM, RIM 1, RIM1, RIMS1

• 

  WB analysis using 24576-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 24576-1-AP (RIM1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of mouse brain using 24576-1-AP

  IP result of anti-RIM1 (IP:24576-1-AP, 4ug; Detection:24576-1-AP 1:1000) with mouse brain tissue lysate 4000ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 24576-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 24576-1-AP (RIM1 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 24576-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 24576-1-AP (RIM1 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: mouse brain tissue, rat brain tissue
• Positive IP detected in: mouse brain tissue
• Positive IHC detected in: mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

24576-1-AP targets RIM1 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20161

  Product name: Recombinant human RIMS1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 923-1039 aa of BC152435

  Sequence: KSTTLTVPEQQRTTHHRSRSVSPHRGNDQGKPRSRLPNVPLQRSLDEIHPTRRSRSPTRHHDASRSPVDHRTRDVDSQYLSEQDSELLMLPRAKRGRSAECLHTTR

• Full Name: regulating synaptic membrane exocytosis 1
• Calculated Molecular Weight: 1692 aa, 189 kDa
• Observed Molecular Weight: 189 kDa
• GenBank Accession Number: BC152435
• Gene Symbol: RIMS1
• Gene ID (NCBI): 22999
• RRID: AB_2879618
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q86UR5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RIMS1 is a RAS gene superfamily member that regulates synaptic vesicle exocytosis. RIMS1 also plays a role in the regulation of voltage-gated calcium channels during neurotransmitter and insulin release. Mutations in RIMS1 have suggested a role cognition and have been identified as the cause of cone-rod dystrophy type 7.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Neuron; Differential Regulation of Evoked and Spontaneous Release by Presynaptic NMDA Receptors; Authors - ; KO Validated
human	WB	iScience; Using brain cell-type-specific protein interactomes to interpret neurodevelopmental genetic signals in schizophrenia; Authors - Yu-Han H Hsu
human	WB	Neurochem Res; Abnormal Expression of FBXL20 in Refractory Epilepsy Patients and a Pilocarpine-Induced Rat Model.; Authors - Pengfei Fu
		Neuron; Neurexin-1γ drives synaptic transmission through structural integration of neurotransmitter release machinery and postsynaptic receptor nanodomains.; Authors - Nirmala Padmanabhan
mouse	WB	Exp Neurol; Gene knockout of RNA binding motif 5 in the brain alters RIMS2 protein homeostasis in the cerebellum and Hippocampus and exacerbates behavioral deficits after a TBI in mice; Authors - Kara Snyder
rat	WB	Neurochem Int; Effects of exercise-induced fatigue on the morphology of asymmetric synapse and synaptic protein levels in rat striatum.; Authors - Zhifeng Wang